DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-7 and rom-2

DIOPT Version :9

Sequence 1:NP_001286324.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001366679.1 Gene:rom-2 / 183564 WormBaseID:WBGene00004401 Length:348 Species:Caenorhabditis elegans


Alignment Length:151 Identity:28/151 - (18%)
Similarity:58/151 - (38%) Gaps:27/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 WPMFLSTFSHYSAMHLFANMYVMHSFANAAAVSLGKE-----QFLAVYLSAGVFSSLMSVLYKAA 245
            |.:|.....:....|:..|:.:.      .|:.:..|     :...:|....:|.|::|:.....
 Worm   170 WRLFTYCLINVGIFHIIFNILIQ------LAIGVPLELVHRWRIYILYFMGVLFGSILSLALDPT 228

  Fly   246 TSQAGMSLGASGAIMTLLAYVCTQYPDTQLSILFLPALTFSAGAGIKVLMGIDFAGVVMGWKFF- 309
            ....|.:.|:...|.:.:..:.|.:.:.:.:...||.|.        |...:|:. :.:..:|| 
 Worm   229 VFLCGGAAGSFSLIASHITTIATNFKEMENATCRLPILI--------VFAALDYV-LAVYQRFFA 284

  Fly   310 ---DHAA---HLGGAMFGIFW 324
               |..:   ||||.:.||.:
 Worm   285 PRIDKVSMYGHLGGLVAGILF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-7NP_001286324.1 Rhomboid 186..327 CDD:396315 28/151 (19%)
rom-2NP_001366679.1 EF-hand_7 21..82 CDD:404394
Rhomboid 165..311 CDD:396315 28/151 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.