DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-7 and rom-2

DIOPT Version :10

Sequence 1:NP_523704.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001366679.1 Gene:rom-2 / 183564 WormBaseID:WBGene00004401 Length:348 Species:Caenorhabditis elegans


Alignment Length:151 Identity:28/151 - (18%)
Similarity:58/151 - (38%) Gaps:27/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 WPMFLSTFSHYSAMHLFANMYVMHSFANAAAVSLGKE-----QFLAVYLSAGVFSSLMSVLYKAA 245
            |.:|.....:....|:..|:.:.      .|:.:..|     :...:|....:|.|::|:.....
 Worm   170 WRLFTYCLINVGIFHIIFNILIQ------LAIGVPLELVHRWRIYILYFMGVLFGSILSLALDPT 228

  Fly   246 TSQAGMSLGASGAIMTLLAYVCTQYPDTQLSILFLPALTFSAGAGIKVLMGIDFAGVVMGWKFF- 309
            ....|.:.|:...|.:.:..:.|.:.:.:.:...||.|.        |...:|:. :.:..:|| 
 Worm   229 VFLCGGAAGSFSLIASHITTIATNFKEMENATCRLPILI--------VFAALDYV-LAVYQRFFA 284

  Fly   310 ---DHAA---HLGGAMFGIFW 324
               |..:   ||||.:.||.:
 Worm   285 PRIDKVSMYGHLGGLVAGILF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-7NP_523704.1 Rhomboid 186..327 CDD:426384 28/151 (19%)
rom-2NP_001366679.1 EF-hand_7 21..82 CDD:463900
Rhomboid 165..313 CDD:426384 28/151 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.