DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-7 and Rhbdl1

DIOPT Version :9

Sequence 1:NP_001286324.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_008765759.1 Gene:Rhbdl1 / 117025 RGDID:620699 Length:433 Species:Rattus norvegicus


Alignment Length:263 Identity:52/263 - (19%)
Similarity:82/263 - (31%) Gaps:73/263 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DIRRHW----DSLTPGDKMFAPILLCNLVAFAMWRVPALKSTMITY--------FTSNPAAKVVC 185
            ::.|.|    ....|.....|.:.|..::.|..:.....|..:.||        ...:|..:...
  Rat   176 EVDRRWYFYRHRTCPPPVFMASVTLAQIIVFLCYGARLNKWVLQTYHPEYMKSPLVYHPGHRARA 240

  Fly   186 WPMFLSTFSHYSAMHLFAN----------------------MYVMHSFANAAAVSLGKEQFLAVY 228
            |......|.|.....|..|                      :|:....|.:..||:...:...|.
  Rat   241 WRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHGVLRISLLYLAGVLAGSLTVSITDMRAPVVG 305

  Fly   229 LSAGVFSSLMSVLYKAATSQAGMSLGASGAIMTLLAYVC-TQYPDTQLSILFLPALTFS------ 286
            .|.||::...:.|.....:.|||..... .:..:||.|| :......:.:.|.|.|..|      
  Rat   306 GSGGVYALCSAHLANVVMNWAGMRCPYK-LLRMVLALVCMSSEVGRAVWLRFSPPLPASGPQPSF 369

  Fly   287 ----AGAGIKVLMGI-----------DFAG---VVMGWKFFDHAAHLGGAMFGIFWATY-----G 328
                |||.:.|.||:           |..|   |::.:..|        .:|.|||..:     |
  Rat   370 MAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTF--------LLFAIFWNVFAYDLLG 426

  Fly   329 AQI 331
            |.|
  Rat   427 ADI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-7NP_001286324.1 Rhomboid 186..327 CDD:396315 39/187 (21%)
Rhbdl1XP_008765759.1 Rhomboid 234..388 CDD:279958 32/154 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.