DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3GALT1

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_066191.1 Gene:B3GALT1 / 8708 HGNCID:916 Length:326 Species:Homo sapiens


Alignment Length:325 Identity:101/325 - (31%)
Similarity:156/325 - (48%) Gaps:79/325 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 RNKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLS 194
            :|..||||.:.|....|..|..||||||:...|            ||                  
Human    75 KNIPFLVILISTTHKEFDARQAIRETWGDENNF------------KG------------------ 109

  Fly   195 GEGQSLTASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSVMALKH 259
                   ..:..:|::|:..|..:  |:.:.:   ||:.::|||.|:|:|||:|||||::|.::.
Human   110 -------IKIATLFLLGKNADPVL--NQMVEQ---ESQIFHDIIVEDFIDSYHNLTLKTLMGMRW 162

  Fly   260 ISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASSDV 324
            ::..| :.|.|.:|.|.|.|||:.||:..||..:                  |.|:.|       
Human   163 VATFC-SKAKYVMKTDSDIFVNMDNLIYKLLKPS------------------TKPRRR------- 201

  Fly   325 LYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYLEDV 389
            .:.....|..|:.:|.||||||..:|...:||.:.||.||:.|.||.:.:::.||:|.|::||||
Human   202 YFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDV 266

  Fly   390 YITGLCAQKAKINRHHHPL--FSFAHSK---QMCAFKGTITQHQLKDDSMVSAWNYVSNYS-IKC 448
            |: |||.:|..|    ||.  ..|.|.|   .:|.::..||.||:..:.|...||.:|:.. ::|
Human   267 YV-GLCLRKLGI----HPFQNSGFNHWKMAYSLCRYRRVITVHQISPEEMHRIWNDMSSKKHLRC 326

  Fly   449  448
            Human   327  326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 69/202 (34%)
B3GALT1NP_066191.1 Galactosyl_T 92..279 CDD:250845 79/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4102
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.