DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3GALT2

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_003774.1 Gene:B3GALT2 / 8707 HGNCID:917 Length:422 Species:Homo sapiens


Alignment Length:355 Identity:100/355 - (28%)
Similarity:153/355 - (43%) Gaps:87/355 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 VIVPKDFCRNKT-FLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDR 185
            :|...:.|:.|: ||::.:.........|..||:||||                           
Human   139 IINEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGN--------------------------- 176

  Fly   186 LKMYGDYLSGEGQSLTASVRI--VFIVGRQKDEAMLGNETLNR-IHIESEKYNDIIQENFVDSYN 247
                        :||...::|  :|::|.    ::..|..|.| |..||.:|:||||:.::|:|.
Human   177 ------------ESLAPGIQITRIFLLGL----SIKLNGYLQRAILEESRQYHDIIQQEYLDTYY 225

  Fly   248 NLTLKSVMALKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVT 312
            |||:|::|.:..::..|.:.. |.:|.|.|.|||...|:|.||...:|         .|..|.. 
Human   226 NLTIKTLMGMNWVATYCPHIP-YVMKTDSDMFVNTEYLINKLLKPDLP---------PRHNYFT- 279

  Fly   313 APQTRLKASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEA 377
                          |:......|.....||||||..:|..|.||.:.||.||:.|.|:.:::|:.
Human   280 --------------GYLMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKV 330

  Fly   378 SLNTTLVYLEDVYITGLCAQKAKINRHHHP-LFSFAH---SKQMCAFKGTITQHQLKDDSMVSAW 438
            ||....::|||||: |:|..|.:|:....| .|.|.|   |...|.:...||.||.:...::..|
Human   331 SLGIRRLHLEDVYV-GICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYW 394

  Fly   439 NYV-SNYSIKC-----PPPGRYFSQVRLRK 462
            |:: .|....|     ...|||    |.||
Human   395 NHLQQNKHNACANAAKEKAGRY----RHRK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 66/205 (32%)
B3GALT2NP_003774.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..110
Galactosyl_T 165..359 CDD:250845 75/262 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6730
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.