DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3GNT9

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_171608.2 Gene:B3GNT9 / 84752 HGNCID:28714 Length:402 Species:Homo sapiens


Alignment Length:324 Identity:86/324 - (26%)
Similarity:131/324 - (40%) Gaps:88/324 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLSGEGQS 199
            |:|||.:..::|.:|..:|:|||        |.|::.|                           
Human   118 LLIAVKSVAEDFERRQAVRQTWG--------AEGRVQG--------------------------- 147

  Fly   200 LTASVRIVFIVGRQK-------DEAMLGNETLNR--IHIESEKYNDIIQENFVDSYNNLTLKSVM 255
              |.||.||::|..:       ||...|..|..|  :..||..|.||:...|.|::.|||||.:.
Human   148 --ALVRRVFLLGVPRGAGSGGADEVGEGARTHWRALLRAESLAYADILLWAFDDTFFNLTLKEIH 210

  Fly   256 ALKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKA 320
            .|...|..|.:....| |.|.|.|||:.|||.||                       ||:   ..
Human   211 FLAWASAFCPDVRFVF-KGDADVFVNVGNLLEFL-----------------------APR---DP 248

  Fly   321 SSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVY 385
            :.|:|.|....:..|:...:||:|:|..:|...:||.|..|.|:::|...:.||..|.....|..
Human   249 AQDLLAGDVIVHARPIRTRASKYYIPEAVYGLPAYPAYAGGGGFVLSGATLHRLAGACAQVELFP 313

  Fly   386 LEDVYITGLCAQKAKINRHHHPLF---------SFAHSKQM--CAFKGTITQHQLKDDSMVSAW 438
            ::||:: |:|.|:.::....||.|         :..|....  |.::..:..|.|   |....|
Human   314 IDDVFL-GMCLQRLRLTPEPHPAFRTFGIPQPSAAPHLSTFDPCFYRELVVVHGL---SAADIW 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 63/211 (30%)
B3GNT9NP_171608.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..83
Galactosyl_T 130..334 CDD:304462 72/268 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.