DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and AT1G77810

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001319398.1 Gene:AT1G77810 / 844443 AraportID:AT1G77810 Length:387 Species:Arabidopsis thaliana


Alignment Length:273 Identity:59/273 - (21%)
Similarity:104/273 - (38%) Gaps:87/273 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 RNKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLS 194
            |.|.|:|:.:.|...:..:|.::||||       .|...||             :||:.      
plant   115 RKKVFMVMGINTAFSSRKRRDSVRETW-------MPQGEKL-------------ERLEQ------ 153

  Fly   195 GEGQSLTASVRIVFIVGRQKDEAMLGNETLNR-IHIESEKYNDIIQENFVDSYNNLTLKSVMALK 258
                  ...:.|.|::|    .:...|..|:| |..|..::.|.::...|:.|:.|:.|      
plant   154 ------EKGIVIKFMIG----HSATSNSILDRAIDSEDAQHKDFLRLEHVEGYHELSAK------ 202

  Fly   259 HISRSCFNTAV------YFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTR 317
              ::..|:|||      :::|.|||..||:..|.:.|                          .|
plant   203 --TKIFFSTAVAKWDAEFYIKVDDDVHVNLGMLASTL--------------------------AR 239

  Fly   318 LKASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYL---SGAGYLMSIDVVQRLFEASL 379
            .::...|..|......| :::.:.|::.|.|....|...||.   :|..|.:|.|:...:   |:
plant   240 HRSKPRVYIGCMKSGPV-LAQKTVKYHEPEYWKFGEDGNKYFRHATGQIYAISKDLANYI---SI 300

  Fly   380 NTTLVYL---EDV 389
            |..:::.   |||
plant   301 NQPILHKYANEDV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 44/199 (22%)
AT1G77810NP_001319398.1 PLN03193 6..384 CDD:178735 59/273 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.