DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3GNT5

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_114436.1 Gene:B3GNT5 / 84002 HGNCID:15684 Length:378 Species:Homo sapiens


Alignment Length:345 Identity:99/345 - (28%)
Similarity:159/345 - (46%) Gaps:74/345 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 KDFCR-NKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMY 189
            |:.|: ....|::.|.|..:|:.:|..||.||||.   ||..                       
Human    80 KEKCQAQDVLLLLFVKTAPENYDRRSGIRRTWGNE---NYVR----------------------- 118

  Fly   190 GDYLSGEGQSLTASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSV 254
                    ..|.|:::.:|.:|  ....:.|.|...::..|.::||||||::||||:.|||||.:
Human   119 --------SQLNANIKTLFALG--TPNPLEGEELQRKLAWEDQRYNDIIQQDFVDSFYNLTLKLL 173

  Fly   255 MALKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLK 319
            |.....:..|.: |.:.:..|||.|:::|||:.                     ||.:..|..::
Human   174 MQFSWANTYCPH-AKFLMTADDDIFIHMPNLIE---------------------YLQSLEQIGVQ 216

  Fly   320 ASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEAS--LNTT 382
               |...|.......|:.:.|||:|:...||:..:||.|.:||.|::|.||..:::|||  ||::
Human   217 ---DFWIGRVHRGAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISGDVAAKVYEASQTLNSS 278

  Fly   383 LVYLEDVYITGLCAQKAKINRHHHPLFSFAHSK---QMCAFKGTITQHQLKDDSMVSAWNYVSNY 444
            | |::||:: ||||.|..|....|..|| ...|   ..|.::..:|.|...:| :...|...::.
Human   279 L-YIDDVFM-GLCANKIGIVPQDHVFFS-GEGKTPYHPCIYEKMMTSHGHLED-LQDLWKNATDP 339

  Fly   445 SIKCPPPGRYFSQV--RLRK 462
            .:|....| :|.|:  ||.|
Human   340 KVKTISKG-FFGQIYCRLMK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 66/204 (32%)
B3GNT5NP_114436.1 Galactosyl_T 102..299 CDD:389837 77/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.