DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and AT1G27120

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_174032.2 Gene:AT1G27120 / 839601 AraportID:AT1G27120 Length:673 Species:Arabidopsis thaliana


Alignment Length:363 Identity:83/363 - (22%)
Similarity:134/363 - (36%) Gaps:102/363 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LDVHK-RSAGLPDWTSETSRSIADYLDIGLSSGVIVPKDFCRNKTFLVIAVCTGVDNFIQRHTIR 153
            :|||. .:|.||    .|:.|.|....:.:......| ...:....|.|.:.:..::|.:|..:|
plant   386 IDVHSVYAASLP----STNPSFAPQKHLEMQRIWKAP-SLPQKPVELFIGILSAGNHFAERMAVR 445

  Fly   154 ETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLSGEGQSLTASVRIV---FIVGRQKD 215
            ::|..                                       |.|..|.::|   |:....:.
plant   446 KSWMQ---------------------------------------QKLVRSSKVVARFFVALHARK 471

  Fly   216 EAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSVMALKHISRSCFNT--AVYFLKCDDDT 278
            |.   |..|.:   |:|.:.||:...::|.|:.:.||:|.    |.....||  |.|.:||||||
plant   472 EV---NVDLKK---EAEYFGDIVIVPYMDHYDLVVLKTVA----ICEYGVNTVAAKYVMKCDDDT 526

  Fly   279 FVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASSDVLYGHQFCNVVPVSEVSSKW 343
            ||.:.                          .|.....::|....:..|:...|..|:.  :.||
plant   527 FVRVD--------------------------AVIQEAEKVKGRESLYIGNINFNHKPLR--TGKW 563

  Fly   344 YMPSYMYKPESYPKYLSGAGYLMSIDVVQRL---FEASLNTTLVYLEDVYITGLCAQKAKINRHH 405
            .:....:..|.||.|.:|.||::|.||.:.:   ||.. ...|..:|||.: |:..:|....|  
plant   564 AVTFEEWPEEYYPPYANGPGYILSYDVAKFIVDDFEQK-RLRLFKMEDVSM-GMWVEKFNETR-- 624

  Fly   406 HPLFSFAHSKQMCAFKGTI----TQHQLKDDSMVSAWN 439
             |: :..||.:.|.| |.|    |.|......|:..|:
plant   625 -PV-AVVHSLKFCQF-GCIEDYFTAHYQSPRQMICMWD 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 53/210 (25%)
AT1G27120NP_174032.2 Gal-bind_lectin 187..391 CDD:278752 3/4 (75%)
Galactosyl_T 439..619 CDD:304462 57/258 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.