DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and GALT1

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001319087.1 Gene:GALT1 / 839224 AraportID:AT1G26810 Length:643 Species:Arabidopsis thaliana


Alignment Length:380 Identity:91/380 - (23%)
Similarity:143/380 - (37%) Gaps:112/380 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 SAGLPDWTSETSRSIADYLDIGLSSGVIVPKDFCRNKTFLVIAVCTGVDNFIQRHTIRETWGNTT 160
            ::|||  |||.|..:.| |: .|.|..:.|    .....|||.|.:..:||.:|..:|.||    
plant   363 ASGLP--TSEESEHVVD-LE-ALKSPTLSP----LRPLDLVIGVFSTANNFKRRMAVRRTW---- 415

  Fly   161 EFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLSGEGQSLTASVRIVFIVGRQKDEAMLGNETLN 225
                                      ..|.|..||.       |.:.|.||..| ..::..|..|
plant   416 --------------------------MQYDDVRSGR-------VAVRFFVGLHK-SPLVNLELWN 446

  Fly   226 RIHIESEKYNDIIQENFVDSYNNLTLKSVMALKHISRSCFNTAV----YFLKCDDDTFVNIPNLL 286
                |:..|.|:....|||.|      |:::.|.::...|.|.|    :.:|.|||.||.:..:|
plant   447 ----EARTYGDVQLMPFVDYY------SLISWKTLAICIFGTEVDSAKFIMKTDDDAFVRVDEVL 501

  Fly   287 NFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYK 351
            .     ::.:.|:|                     ..::||....:..|:....||||:....:.
plant   502 L-----SLSMTNNT---------------------RGLIYGLINSDSQPIRNPDSKWYISYEEWP 540

  Fly   352 PESYPKYLSGAGYLMSIDV---VQRLFEASLNTTLVYLEDVYITGLCAQKAK--INRHHHPLFSF 411
            .|.||.:..|.||::|.|:   |.:||:.. |..:..||||.:....|:..|  :..|:..    
plant   541 EEKYPPWAHGPGYIVSRDIAESVGKLFKEG-NLKMFKLEDVAMGIWIAELTKHGLEPHYEN---- 600

  Fly   412 AHSKQMCAFKGTITQHQLKDDSMVSAWNYVSNYSIKCPPPGRYFSQVRLRKRPIC 466
                     .|.|.....||..:|:  :|.|...:.|     .:.:.:..||.:|
plant   601 ---------DGRIISDGCKDGYVVA--HYQSPAEMTC-----LWRKYQETKRSLC 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 54/211 (26%)
GALT1NP_001319087.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.