DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and AT1G11730

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_172638.1 Gene:AT1G11730 / 837717 AraportID:AT1G11730 Length:384 Species:Arabidopsis thaliana


Alignment Length:394 Identity:79/394 - (20%)
Similarity:139/394 - (35%) Gaps:132/394 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 NRM----PLPRMLRRLGCYTLSAFLICGLLLVYLPLVYLDVHKRSAGLPDWTSETSRSIADYLDI 116
            |||    |..|.:.||...:||: ..|....|      ||....:.|:.|      :||:: |::
plant    38 NRMWNIVPEARGISRLSKLSLSS-SDCDKKNV------LDYGNNTIGILD------KSISN-LEM 88

  Fly   117 ----------GLSSGVIVPKDFCRNKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLH 171
                      .||....:..:..:.|.|:||.:.|...:..:|.::|.||               
plant    89 KLVAARAERESLSGKFNISNEAKKRKYFMVIGINTAFSSRKRRDSVRSTW--------------- 138

  Fly   172 GHLKGHYLPPLPDRLKMYGDYLSGEGQSLTASVRIVFIVGRQKDEAMLGNETLNR-IHIESEKYN 235
                    .|..:.||...:         ...:.:.|::|    .::|.:..|:: |..|.:.:.
plant   139 --------MPQGENLKKLEE---------EKGIIVRFVIG----HSVLSHGILDKAIEAEEKTHG 182

  Fly   236 DIIQENFVDSYNNLTLKSVMALKHISRSCFNTAV------YFLKCDDDTFVNIPNLLNFLLGGTI 294
            |.::....:.|..|:.|        :::.|.|||      :::|.|||..||:.:|         
plant   183 DFLRLEHTEGYMKLSAK--------TKTFFATAVSLWDAEFYIKVDDDVHVNLASL--------- 230

  Fly   295 PLYNDTLDYHDRSTYLVTAPQTRLKASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPE---SYP 356
               ...|..|.....:...    ...|..||           :..|.|::.|.|....|   .|.
plant   231 ---KKALSAHQNKPRVYVG----CMKSGPVL-----------ARKSVKYHEPEYWKFGEVGNKYF 277

  Fly   357 KYLSGAGYLMSIDVVQRLFEASLNTTLVYL---EDV----YITGLCAQKAKINRHHHPLFSFAHS 414
            ::.:|..|.:|.|:...:.   :|..|::.   |||    :..||       |..|      ...
plant   278 RHATGQFYAISKDLATYIL---INQDLLHKYANEDVSLGSWFIGL-------NVEH------VDE 326

  Fly   415 KQMC 418
            |::|
plant   327 KRLC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 45/219 (21%)
AT1G11730NP_172638.1 PLN03193 1..382 CDD:178735 79/394 (20%)
DUF4094 18..96 CDD:290073 18/71 (25%)
Galactosyl_T 129..325 CDD:304462 52/282 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.