DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and AT4G26940

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_567762.1 Gene:AT4G26940 / 828801 AraportID:AT4G26940 Length:407 Species:Arabidopsis thaliana


Alignment Length:412 Identity:79/412 - (19%)
Similarity:141/412 - (34%) Gaps:141/412 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DRRWNPEKIEEQSSLLAAEYSSSSGAAASGSEDETVTTSGALRSKAKLRKRQLRNRMPLPRMLRR 66
            ||.|.    |.:|::::.:..:|.......|||        ..|..|..||:.::          
plant    40 DRMWP----EPESNVVSRDTVASDERLRLESED--------CDSSKKGLKRESKD---------- 82

  Fly    67 LGCYTLSAFLICGLLLVYLPLVYLDVHKRSAGLPDWTSETSRSIADYLDI-----GLSSGVIVPK 126
                      |.|           ||:|....:.......|:...:..|.     .:.:|..|..
plant    83 ----------ILG-----------DVYKSPDAIQTLDKTISKLETELADARAAQESIMNGSPVSD 126

  Fly   127 DF------CRNKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDR 185
            ||      .:.|..:|:.|.|...:..:|.::|.||                      :||..:|
plant   127 DFKLPETVTKRKYLMVVGVNTAFSSRKRRDSVRATW----------------------MPPGEER 169

  Fly   186 LKMYGDYLSGEGQSLTASVRIVFIVGRQKDEAMLGNETLNR-IHIESEKYNDIIQENFVDSYNNL 249
            .|:..:          ..:.:.|::|.......:    |:| |..|..|:.|.::.:.|:.|..|
plant   170 KKLEEE----------KGIVMRFVIGHSSTPGGI----LDRAIQAEESKHGDFLRLDHVEGYLEL 220

  Fly   250 TLKSVMALKHISRSCFNTAV------YFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRST 308
            :.|        :::.|.||.      :::|.|||..|||..     ||..:..|           
plant   221 SAK--------TKTYFTTAFAMWDADFYVKVDDDVHVNIAT-----LGAELARY----------- 261

  Fly   309 YLVTAPQTRLKASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYL---SGAGYLMSIDV 370
                    |:|..  |..|......| :::...:::.|.|....|...||.   :|..|.:|.::
plant   262 --------RMKPR--VYIGCMKSGPV-LAQKGVRYHEPEYWKFGEEGNKYFRHATGQLYAISREL 315

  Fly   371 VQRLFEASLNTTLVYL---EDV 389
            ...:   |:|..:::.   |||
plant   316 ASYI---SINQNVLHKYVNEDV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 43/199 (22%)
AT4G26940NP_567762.1 PLN03193 1..407 CDD:178735 79/412 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.