DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and AT3G14960

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_188114.1 Gene:AT3G14960 / 820725 AraportID:AT3G14960 Length:343 Species:Arabidopsis thaliana


Alignment Length:340 Identity:75/340 - (22%)
Similarity:128/340 - (37%) Gaps:82/340 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LSAFLICGLLLVYLPLVYLDVHKRSAGLPDWTSETSRSIADYLDIGLSSGVIVPKDFCRNKTFLV 136
            |:.||. ||..:..|.:.|........||   .:|.:.:.|     ::...||..:..|:|....
plant    32 LTGFLF-GLSTILFPGLRLSGRSCLTNLP---PKTVKIVWD-----VAGNSIVNGEVKRHKVMGF 87

  Fly   137 IAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLSGEGQSLT 201
            :.:.||..:..:|..:|.||                      :|..|:.|:...:         :
plant    88 VGIQTGFRSAGRRRALRNTW----------------------MPSDPEGLRRLEE---------S 121

  Fly   202 ASVRIVFIVGRQKDEAMLGNETLNRIHIESE--KYNDIIQENFVDSYNNLTLKSVMALKHISRSC 264
            ..:.|.||:|:.||||.:       :.:.||  .|:|.|..:..:.|:.|..|::...|  :...
plant   122 TGLAIRFIIGKTKDEAKM-------VELRSEVAMYDDFILLDIEEEYSKLPYKTLAFFK--AAYA 177

  Fly   265 FNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASSDVLYGHQ 329
            ...:.:::|.|||.::. |:.|:.||         ..:.....|||....:           |..
plant   178 LYDSEFYVKADDDIYLR-PDRLSLLL---------AKERGHSQTYLGCMKK-----------GPV 221

  Fly   330 FCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYL-EDVYITG 393
            |      ::...|||.|......:.|..:..|..|.:|.|||..|.....|:..::. |||.|. 
plant   222 F------TDPKLKWYEPLADLLGKEYFLHAYGPIYALSADVVTSLVALKNNSFRMFSNEDVTIG- 279

  Fly   394 LCAQKAKINRHHHPL 408
              |....:|.:|..|
plant   280 --AWMLAMNVNHENL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 50/205 (24%)
AT3G14960NP_188114.1 Galactosyl_T 99..293 CDD:304462 58/264 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.