DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and AT2G32430

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_180802.1 Gene:AT2G32430 / 817804 AraportID:AT2G32430 Length:409 Species:Arabidopsis thaliana


Alignment Length:274 Identity:58/274 - (21%)
Similarity:101/274 - (36%) Gaps:89/274 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 RNKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLS 194
            :.:..:|:.:.|...:..:|.::|.||                      :|....|.|:..:   
plant   137 KRRYLMVVGINTAFSSRKRRDSVRTTW----------------------MPSGEKRKKLEEE--- 176

  Fly   195 GEGQSLTASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSVMALKH 259
                   ..:.|.|::|.   .|..|......|..|.:|:.|.::.:.|:.|..|:.|       
plant   177 -------KGIIIRFVIGH---SATAGGILDRSIEAEDKKHGDFLRLDHVEGYLELSGK------- 224

  Fly   260 ISRSCFNTAV------YFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRS--TYLVTAPQT 316
             :::.|:|||      :::|.|||..|||..|            .:||..|.:.  .||      
plant   225 -TKTYFSTAVSKWDAEFYVKVDDDVHVNIATL------------GETLVRHRKKHRVYL------ 270

  Fly   317 RLKASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYL---SGAGYLMSIDVVQRLFEAS 378
            ....|..||           |:...:::.|.|....|:..||.   :|..|.:|.|:...:   |
plant   271 GCMKSGPVL-----------SQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYI---S 321

  Fly   379 LNTTLVYL---EDV 389
            ||..:::.   |||
plant   322 LNQHVLHKYANEDV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 49/200 (25%)
AT2G32430NP_180802.1 PLN03193 1..409 CDD:178735 58/274 (21%)
DUF4094 17..115 CDD:290073
Galactosyl_T 154..352 CDD:304462 56/257 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.