DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and si:dkeyp-98a7.1

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001138282.1 Gene:si:dkeyp-98a7.1 / 796449 ZFINID:ZDB-GENE-050208-519 Length:367 Species:Danio rerio


Alignment Length:271 Identity:74/271 - (27%)
Similarity:115/271 - (42%) Gaps:66/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 DFCRNKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGD 191
            |.|:...|||:.|....:....|:.||.||||.|                               
Zfish   111 DVCKENPFLVLMVPVAPNQIDARNAIRSTWGNET------------------------------- 144

  Fly   192 YLSGEGQSLTASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSVMA 256
              :.:|:::.....:..|||...::|.      .::..||.::.|:||.||||||.|||:|:::.
Zfish   145 --TVQGKAVLTLFLVGLIVGADSEKAQ------QQLEEESRQHRDLIQSNFVDSYFNLTIKTMVI 201

  Fly   257 LKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKAS 321
            :..::..| ..|.|.:|.|.|.|:|:.||:.                      |::||.|   ..
Zfish   202 MGWLATRC-PQANYSMKIDSDMFLNVDNLVT----------------------LLSAPNT---PR 240

  Fly   322 SDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYL 386
            .:.:.|....|...|....||||:...:|...:||.||.|.||:.|.|:..::.|||.......:
Zfish   241 ENYITGMVMWNRPVVRSKDSKWYVSEELYPEPTYPTYLLGMGYVFSNDLPSKIVEASKYVKPFNI 305

  Fly   387 EDVYITGLCAQ 397
            ||.|| |.|.:
Zfish   306 EDAYI-GACVK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 59/194 (30%)
si:dkeyp-98a7.1NP_001138282.1 Galactosyl_T 131..325 CDD:304462 68/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.