DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3galt2

DIOPT Version :10

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001102962.1 Gene:B3galt2 / 686081 RGDID:1586615 Length:422 Species:Rattus norvegicus


Alignment Length:49 Identity:12/49 - (24%)
Similarity:20/49 - (40%) Gaps:18/49 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   630 PFVIDKVRVGSALVPPYARKSLQRDRVAQRSRMCSWFAVKSDPVTQMLS 678
            |.::||.:      ||            :|.|...:..:..|||::.||
  Rat   169 PVIMDKRQ------PP------------KRKRNFYYITMLRDPVSRYLS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:473923
B3galt2NP_001102962.1 B3GALT2_N 75..154 CDD:437173
Galactosyl_T 165..359 CDD:426415 12/49 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.