DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and b3galt1b

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:XP_009298719.1 Gene:b3galt1b / 571003 ZFINID:ZDB-GENE-130530-770 Length:331 Species:Danio rerio


Alignment Length:330 Identity:103/330 - (31%)
Similarity:155/330 - (46%) Gaps:79/330 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PKDFCRNKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMY 189
            ||....|..||||.:.|....|..|..||||||:.:.|                           
Zfish    75 PKKCETNVPFLVILITTTHKEFDARQAIRETWGDESTF--------------------------- 112

  Fly   190 GDYLSGEGQSLTASVRIV--FIVGRQKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLK 252
                        :.:||:  |::||..|..:  |:.:.:   |||.::||:.|:|:|||:|||||
Zfish   113 ------------SDLRIITLFLLGRSTDVVL--NQMVEQ---ESEIFHDIVVEDFIDSYHNLTLK 160

  Fly   253 SVMALKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTR 317
            ::|.::.::..| |.|.|.:|.|.|.|||:.||:..||..                  .|.|:.|
Zfish   161 TLMGMRWVATFC-NQAKYVMKTDSDIFVNMDNLVYKLLKP------------------ATKPRRR 206

  Fly   318 LKASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTT 382
                   .:.....|..|:.::.||||||..:|....||.:.||.||:.|.||.:.:::.||:|.
Zfish   207 -------YFTGYVINGGPIRDMRSKWYMPRDLYPESKYPPFCSGTGYVFSADVAELIYKTSLHTR 264

  Fly   383 LVYLEDVYITGLCAQKAKINRHHHPLFSFAHSK---QMCAFKGTITQHQLKDDSMVSAWN-YVSN 443
            |::|||||: |:|.:|..|  |.:....|.|.|   .:|.::..||.||:..:.|...|| ..|.
Zfish   265 LLHLEDVYV-GVCLRKLGI--HPYQNSGFNHWKMAYSLCRYRRVITVHQISPEEMHRIWNDMTSK 326

  Fly   444 YSIKC 448
            ..:||
Zfish   327 KHLKC 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 72/204 (35%)
b3galt1bXP_009298719.1 Galactosyl_T 97..287 CDD:250845 80/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4102
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.