DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and b3galt2

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_996984.1 Gene:b3galt2 / 404633 ZFINID:ZDB-GENE-040426-2078 Length:437 Species:Danio rerio


Alignment Length:328 Identity:96/328 - (29%)
Similarity:144/328 - (43%) Gaps:89/328 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 FLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLSGEGQ 198
            |||:.:.........|:.||:||||.:    .|.|                    ||        
Zfish   164 FLVLLIAAEPRQLEARNAIRQTWGNES----VAMG--------------------YG-------- 196

  Fly   199 SLTASVRIVFIVGR--------QKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSVM 255
                .||: |::||        ..||             ||.:::||||::|:|:|.|||:|::|
Zfish   197 ----FVRL-FLLGRIPNAYPQSSVDE-------------ESLQHHDIIQQDFLDTYYNLTIKTLM 243

  Fly   256 ALKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKA 320
            .:..::|.|.: |.|.:|.|.|.|||...|:..||...                  |||:     
Zfish   244 GMSWVARYCPH-ARYVMKTDSDMFVNTEYLIQKLLKPN------------------TAPR----- 284

  Fly   321 SSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVY 385
             .:...|:......|.....||||||..:|..|.||.:.||.||:.|.|:..:::.|||:...::
Zfish   285 -QNYFTGYLMRGYAPNRNKDSKWYMPPELYSIERYPIFCSGTGYVFSGDMAAKIYNASLSIRRLH 348

  Fly   386 LEDVYITGLCAQKAKINRHHHP-LFSFAH---SKQMCAFKGTITQHQLKDDSMVSAWNYV-SNYS 445
            |||||: |:|..|.:|:....| .|.|.|   |...|.:...||.||.:.:.::..||:: ||..
Zfish   349 LEDVYV-GICLAKLRIDPVPPPNEFLFNHWRVSYSSCKYSHLITSHQFQPNELMKYWNHLQSNKH 412

  Fly   446 IKC 448
            ..|
Zfish   413 NPC 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 67/210 (32%)
b3galt2NP_996984.1 Galactosyl_T 177..369 CDD:250845 78/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24800
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.