DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3GNT8

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001372577.1 Gene:B3GNT8 / 374907 HGNCID:24139 Length:397 Species:Homo sapiens


Alignment Length:449 Identity:104/449 - (23%)
Similarity:167/449 - (37%) Gaps:129/449 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WNPEKIEEQSSLLAAEYSSSSGAAASGSEDETVTTSGALRSKAKLRKRQLRNRMPLPRMLRRLGC 69
            ||    ::|..|         |:..||...||    |..::.......::.:....|:.|||   
Human    73 WN----QQQWRL---------GSLPSGDSTET----GGCQAWGAAAATEIPDFASYPKDLRR--- 117

  Fly    70 YTLSAFLICGLLLVYLPLVYLDVHKRSAGLPDWTSETSRSIADYLDIGLSSGVIVPKDFCRNKTF 134
            :.|||  .|                ||  .|.|......|     .:...|...||        :
Human   118 FLLSA--AC----------------RS--FPQWLPGGGGS-----QVSSCSDTDVP--------Y 149

  Fly   135 LVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLSGEGQS 199
            |::||.:....|.:|..:|||||:                      |.|                
Human   150 LLLAVKSEPGRFAERQAVRETWGS----------------------PAP---------------- 176

  Fly   200 LTASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSVMALKHISRSC 264
               .:|::|::|....||  |.:..:.:..||.:|:|::..:|:|...|.|||.::.|..:.|.|
Human   177 ---GIRLLFLLGSPVGEA--GPDLDSLVAWESRRYSDLLLWDFLDVPFNQTLKDLLLLAWLGRHC 236

  Fly   265 FNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASSDVLY-GH 328
             .|..:.|:..||.||:.|.||                     .:|...|    .||:..|| |.
Human   237 -PTVSFVLRAQDDAFVHTPALL---------------------AHLRALP----PASARSLYLGE 275

  Fly   329 QFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYLEDVYITG 393
            .|...:|:.:....:|:|...:: ..||.|.||.||:::..:...|..|:........|||| ||
Human   276 VFTQAMPLRKPGGPFYVPESFFE-GGYPAYASGGGYVIAGRLAPWLLRAAARVAPFPFEDVY-TG 338

  Fly   394 LCAQKAKINRHHHPLFSFA----HSKQMCAFKGTITQHQLKDDSMVSAWNYVSNYSIKC 448
            ||.:...:....||.|..|    .:...|||:..:....|...:.:..|..:.:..::|
Human   339 LCIRALGLVPQAHPGFLTAWPADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 56/203 (28%)
B3GNT8NP_001372577.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..58
Galactosyl_T 162..349 CDD:419759 64/257 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D174158at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.