DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and beta3GalTII

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster


Alignment Length:304 Identity:81/304 - (26%)
Similarity:128/304 - (42%) Gaps:42/304 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 FLVIAVCTGVDNFIQRHTIRETW----GNTTEFNY--------PAFGKLHGHLKGHYLPPLPDRL 186
            ||::.|.:...|..:|:.:|.||    |.:....|        |.| ...|||:...:.....||
  Fly    50 FLMVLVLSAPHNADERNAMRRTWLANAGQSIAQPYLPEELIYLPTF-NAQGHLQVELVAEQASRL 113

  Fly   187 KMYGDY---LSGEGQSLT---ASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYNDIIQEN-FVD 244
            :.|.::   |..||...|   .:|:.||.:|...    |.:..|..:..|..:.||::..| ..|
  Fly   114 RQYTNWQQSLLTEGPPRTKRLITVKHVFSIGTLD----LSSSALAELEKEQNQNNDLLLLNRHHD 174

  Fly   245 SYNNLTLKSVMALKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTY 309
            :|.|||.|.:.:| :|.|..:..: |.||.||||:|.:.:|:|.|:.....|.....:|.|.   
  Fly   175 TYKNLTAKLMQSL-YILRRHYEFS-YMLKVDDDTYVKLDSLVNTLVSYDRKLLRKRSEYRDH--- 234

  Fly   310 LVTAPQTRLKASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRL 374
              ..||         ||...| |.....:...:|...|| |..::|..|..|.||::|..:...:
  Fly   235 --VLPQ---------LYWGYF-NGRSTIKTKGQWKESSY-YLSKNYLPYALGGGYVLSRSLCDYI 286

  Fly   375 FEASLNTTLVYLEDVYITGLCAQKAKINRHHHPLFSFAHSKQMC 418
            ...|...:....|||.:....|....:.|.|.|.|..:::.:.|
  Fly   287 VNNSQLLSHYGSEDVSVGTWLAPLRHVYRWHDPRFDTSYAPRKC 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 56/203 (28%)
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 59/215 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465006
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.