DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3gnt7

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001012134.1 Gene:B3gnt7 / 316583 RGDID:1310580 Length:397 Species:Rattus norvegicus


Alignment Length:330 Identity:91/330 - (27%)
Similarity:144/330 - (43%) Gaps:75/330 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CRNKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYL 193
            |....:|::.|.:.:....:|..||:|||:..|    :.|              |||        
  Rat   126 CAGDVYLLVVVKSVITQHDRREVIRQTWGHEWE----SAG--------------PDR-------- 164

  Fly   194 SGEGQSLTASVRIVFIVG-RQKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSVMAL 257
                    .:||.:|::| ..|.|.....:.|  :..|...|.||:|.:|:||:.|||||.:..|
  Rat   165 --------GAVRTLFLLGTASKQEERTHYQQL--LAYEDRLYGDILQWDFLDSFFNLTLKEIHFL 219

  Fly   258 KHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASS 322
            |.:...|.|....| |.|||.|||..|||.||              .||.      ||..|.. .
  Rat   220 KWLDIYCPNVPFIF-KGDDDVFVNPTNLLEFL--------------SDRQ------PQENLFV-G 262

  Fly   323 DVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYLE 387
            |||.     :..|:.:..:|:|:|:.||...:||.|..|.|:|||..:.::|..|.....|..::
  Rat   263 DVLK-----HARPIRKKDNKYYIPAVMYSKATYPPYAGGGGFLMSGSLARQLHHACDTLELFPID 322

  Fly   388 DVYITGLCAQKAKINRHHHPLF-SFAHS--------KQMCAFKGTITQHQLKDDSMVSAWNYVSN 443
            ||:: |:|.:...:....|..| :|..|        |:.|.::..:..|:|....:::.|:.|.:
  Rat   323 DVFL-GMCLEVLGVKPTGHEGFKTFGISRVRGSRMNKEPCFYRSMLVVHKLLPAELLAMWDLVHS 386

  Fly   444 YSIKC 448
             ::.|
  Rat   387 -NLTC 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 66/203 (33%)
B3gnt7NP_001012134.1 Galactosyl_T 144..338 CDD:304462 77/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12332
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.