DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and brn

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster


Alignment Length:432 Identity:105/432 - (24%)
Similarity:168/432 - (38%) Gaps:140/432 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KAKLRKRQLRNRMPLPRMLRRLGCYTLSAFLI--CGLLLVYLPLVYLDVH------------KRS 96
            ::|.||..||..:.||.:|           |:  || ||.:|..:..:.|            ..|
  Fly     2 QSKHRKLLLRCLLVLPLIL-----------LVDYCG-LLTHLHELNFERHFHYPLNDDTGSGSAS 54

  Fly    97 AGL--------PDWTSETSRSIADYLDIGLSSGVIVPKDFCRNKTFLVIAVCTGVDNFIQRHTIR 153
            :||        |.:|:|                  ||.|   ....|.:.:.:.|.|..:|..||
  Fly    55 SGLDKFAYLRVPSFTAE------------------VPVD---QPARLTMLIKSAVGNSRRREAIR 98

  Fly   154 ETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLSGEGQSLTASVRIVFIVGRQKDEAM 218
            .|||.                                     ||:.....:|.||::|..:|.. 
  Fly    99 RTWGY-------------------------------------EGRFSDVHLRRVFLLGTAEDSE- 125

  Fly   219 LGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSVMALKHISRSCFNTAVYFLKCDDDTFVNIP 283
                  ..:..||.::.||:|..|.|:|.|.|||:::.::..|.. ||.:.::|..|||.:|:..
  Fly   126 ------KDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQ-FNRSEFYLFVDDDYYVSAK 183

  Fly   284 NLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASSDVLY-GHQFCNVVPVSEVSSKWYMPS 347
            |:|.||..|                        |.....::|: ||.| ...|:....||||:..
  Fly   184 NVLKFLGRG------------------------RQSHQPELLFAGHVF-QTSPLRHKFSKWYVSL 223

  Fly   348 YMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYLEDVYITGLCAQKAKINRHHHPLFSFA 412
            ..|..:.:|.|::...:::|...:::|:.||::..|...:|||: |:.|.||.|:..|...|.|.
  Fly   224 EEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYL-GIVALKAGISLQHCDDFRFH 287

  Fly   413 HSKQMCAFKG------TITQHQLKD-DSMVSAWNYV--SNYS 445
            ..    |:||      .|..|:..| :.|...||..  :||:
  Fly   288 RP----AYKGPDSYSSVIASHEFGDPEEMTRVWNECRSANYA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 57/203 (28%)
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 65/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465009
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2616
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24800
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
98.800

Return to query results.
Submit another query.