DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3gnt9

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:XP_008770778.1 Gene:B3gnt9 / 291958 RGDID:1310170 Length:398 Species:Rattus norvegicus


Alignment Length:350 Identity:88/350 - (25%)
Similarity:135/350 - (38%) Gaps:103/350 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLSGEGQS 199
            |:|||.:...:|.:|..:|:|||        |.|::.|                           
  Rat   119 LLIAVKSVAADFERREAVRQTWG--------AEGRVQG--------------------------- 148

  Fly   200 LTASVRIVFIVGRQKDEAMLGNETLNRIH------IESEKYNDIIQENFVDSYNNLTLKSVMALK 258
              |.||.||::|..|.....|..|  |.|      .||..|.||:...|.|::.|||||.:..|.
  Rat   149 --ALVRRVFLLGVPKGAGSGGAGT--RTHWRALLEAESRAYADILLWAFEDTFFNLTLKEIHFLS 209

  Fly   259 HISRSCFNTAVYFL-KCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASS 322
            ..|..|  ..|:|: |.|.|.||::.|||.||                       .|:   ..:.
  Rat   210 WASAFC--PDVHFVFKGDADVFVHVRNLLQFL-----------------------EPR---DPAQ 246

  Fly   323 DVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYLE 387
            |:|.|.......|:...:||:::|..:|....||.|..|.|:::|...:.||..|.....|..::
  Rat   247 DLLAGDVIVQARPIRARASKYFIPQAVYGLPVYPAYAGGGGFVLSGATLHRLAHACTQVELFPID 311

  Fly   388 DVYITGLCAQKAKINRHHHPLF-SFAHSK----------QMCAFKGTITQHQLKDDSMVSAWNYV 441
            ||:: |:|.|:.::....||.| :|..|:          ..|.::..:..|.|....:...|..:
  Rat   312 DVFL-GMCLQRLRLTPEPHPAFRTFGISQPSAAPHLRTFDPCFYRELVVVHGLSAADIWLMWRLL 375

  Fly   442 SNYSIKCPPPGRYFSQVRLRKRPIC 466
            ..      |.|           |:|
  Rat   376 HG------PQG-----------PVC 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 61/209 (29%)
B3gnt9XP_008770778.1 Galactosyl_T 131..330 CDD:304462 70/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.