DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3galnt2

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001138323.1 Gene:B3galnt2 / 291212 RGDID:1306946 Length:504 Species:Rattus norvegicus


Alignment Length:270 Identity:58/270 - (21%)
Similarity:95/270 - (35%) Gaps:84/270 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 YLSGEGQSLTASV-----RIV-FIVGRQKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLT 250
            |...||.:|..|:     |:| .|...|.::|:|..        ||..|:||:..:.||:|.|:.
  Rat   279 YTVQEGDALLRSLYSRPQRLVDHIRDLQVEDALLQK--------ESSIYDDIVFVDVVDTYRNVP 335

  Fly   251 LKSVMALK-HISRSCFNTAVYFLKCDDDTFVNI--------------PNLL--NFLLGGTIPLYN 298
            .|.:...: .:..:.|:   ..||.|||.::::              ||..  ||.|...:    
  Rat   336 AKLLNFYRWTVESTSFS---LLLKTDDDCYIDLEAVFNRIAQKNLDGPNFWWGNFRLNWAV---- 393

  Fly   299 DTLDYHDRSTYLVTAPQTRLKASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAG 363
                  ||                                 :.||  ....|...:||.:..|:|
  Rat   394 ------DR---------------------------------TGKW--QELEYPSPAYPAFACGSG 417

  Fly   364 YLMSIDVVQRLFEASLNTTLVYLEDVYITGLCAQKAKINRHHHPLFSFAHSKQMCAFKGTITQHQ 428
            |::|.|:|..|...|........|||.: |:........||...|:.   .::.|. .|.::..|
  Rat   418 YVISKDIVDWLAGNSGRLKTYQGEDVSM-GIWMAAIGPKRHQDSLWL---CEKTCE-TGMLSSPQ 477

  Fly   429 LKDDSMVSAW 438
            ...:.:...|
  Rat   478 YSPEELSKLW 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 48/225 (21%)
B3galnt2NP_001138323.1 Galactosyl_T 309..459 CDD:304462 44/206 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.