DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3gnt3

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001099538.1 Gene:B3gnt3 / 290638 RGDID:1305151 Length:378 Species:Rattus norvegicus


Alignment Length:392 Identity:91/392 - (23%)
Similarity:150/392 - (38%) Gaps:108/392 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 PDWTSETSRSIADYLDIGLS-----SGVIVP------------KDF----------CRNKTFLVI 137
            |.|..:.||:.|......||     :...:|            :||          |....||::
  Rat    44 PAWAPDLSRAHAAPCRANLSVSAHPAFARLPSHVRDFLLYRHCRDFAVLREPKATKCAQPAFLLL 108

  Fly   138 AVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLSGEGQSLTA 202
            |:.:...|:.:|..:|.||..                                     |.:...|
  Rat   109 AIKSSPANYGRRQVLRTTWAR-------------------------------------ERRVRGA 136

  Fly   203 SVRIVFIVGRQKDEAMLGNETLNR-IHIESEKYNDIIQENFVDSYNNLTLKSVMALKHISRSCFN 266
            |:|.:|:||..:|....  ...|| :.:|::.|.||:|.:|.||:.|||||.|:.|:.....|.|
  Rat   137 SLRRLFLVGSDRDPQQA--RKFNRLLELEAKAYGDILQWDFHDSFFNLTLKQVLFLEWQRTHCTN 199

  Fly   267 TAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASSDVLYGHQFC 331
             |.:.|..|||.|.:..|::.:|.|      .|. |.|                   :..||...
  Rat   200 -ASFVLNGDDDVFAHTDNMVTYLQG------RDP-DQH-------------------LFVGHLIQ 237

  Fly   332 NVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYLEDVYITGLCA 396
            ||.|:....||:::|:.:...:.||.|..|.|:|:|...:..|..|:....:..::||:: |:|.
  Rat   238 NVGPIRVPWSKYFIPTLVTAEDKYPPYCGGGGFLLSRFTMAALHRAARVLPIFPIDDVFL-GMCL 301

  Fly   397 QKAKINRHHH---------PLFSFAHSKQMCAFKGTITQHQLKDDSMVSAWNYVSNYSIKC---- 448
            |:..:....|         |......|...|.::..:..|:.....|:..|:.:|...:.|    
  Rat   302 QQQGLAPGAHSGVRTAGVLPPSPRVSSFDPCFYRDLLLVHRFLPFEMLLMWDALSRPQLACGRQS 366

  Fly   449 PP 450
            ||
  Rat   367 PP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 59/212 (28%)
B3gnt3NP_001099538.1 Galactosyl_T 119..308 CDD:419759 65/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12332
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.