DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3galt5

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001099357.1 Gene:B3galt5 / 288161 RGDID:1306727 Length:308 Species:Rattus norvegicus


Alignment Length:397 Identity:99/397 - (24%)
Similarity:159/397 - (40%) Gaps:121/397 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SAFLICGLLLVY--------LPLVYLDVHKRSAGLPDWTSETSRSIADYLDIGLSSGVIVPKDFC 129
            ::.|..|.|.:|        ||.|:...|.:...||:            :|             |
  Rat    11 ASVLTMGALCLYFSMESFQELPFVFKKSHGKFLQLPE------------ID-------------C 50

  Fly   130 RNK-TFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYL 193
            :.| .|||:.|.:.......|..||:|||..|                                 
  Rat    51 KQKPPFLVLLVTSSHKQLAARMAIRKTWGRET--------------------------------- 82

  Fly   194 SGEGQSLTASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSVMALK 258
            |.:||    .||..|::|...     ..|.::...:|||::.||||::|.|:|.|||||::|.::
  Rat    83 SVQGQ----PVRTFFLLGSSD-----STEDMDATALESEQHRDIIQKDFKDAYFNLTLKTMMGME 138

  Fly   259 HISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASSD 323
            .:...|..|| |.:|.|.|.|||:..|...||            ..:::|...|.          
  Rat   139 WVYHFCPQTA-YVMKTDSDMFVNVGYLTELLL------------KKNKTTRFFTG---------- 180

  Fly   324 VLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYLED 388
            .:..|.|    |:.:..:||::..:.|..:.||.:.||.||:.|.||..:::..|.:...:.|||
  Rat   181 YIKPHDF----PIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSESVPFIKLED 241

  Fly   389 VYITGLCAQKAKINRHHHPLFSFAHSKQ----------MCAFKGTITQHQLKDDSMVSAWNYV-S 442
            |:: |||..|.||....      .|:||          :|.|:..:..|.:|...:::.|..: :
  Rat   242 VFV-GLCLAKLKIRPEE------LHTKQTFFPGGLRFSVCRFQKIVACHFMKPQDLLTYWQALET 299

  Fly   443 NYSIKCP 449
            :....||
  Rat   300 SKDEDCP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 62/202 (31%)
B3galt5NP_001099357.1 Galactosyl_T 69..259 CDD:304462 72/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12332
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.