DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3gnt6

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001074636.1 Gene:B3gnt6 / 272411 MGIID:3039603 Length:391 Species:Mus musculus


Alignment Length:440 Identity:104/440 - (23%)
Similarity:172/440 - (39%) Gaps:117/440 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 MPLPRMLRRLGCYTLSAFLICGLLLVYLPLVYLDVHKRSAGLPDWTSETSRSIADYL-------- 114
            |.||.. ||....|..||.:.|:.||.|...:|..|::...  .....|.||:|..:        
Mouse     1 MALPSS-RRFKSPTTLAFFLVGVTLVVLNQWFLQEHRQEKA--KGPVATRRSLAAVVQRSPLFQV 62

  Fly   115 -------DIGLSSGV-IVP---KDFCRNK--------------------TFLVIAVCTGVDNFIQ 148
                   ...|.:|. ::|   :||.|.:                    .||::||.:...::.:
Mouse    63 PPCVANASANLLTGFQLLPARIQDFLRYRHCRRFPQLWDAPPKCAGPRGVFLLLAVKSSPAHYER 127

  Fly   149 RHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLSGEGQSLTASVRIVFIVGRQ 213
            |..||.|||....:                               ||.      .|..:|:||..
Mouse   128 RELIRRTWGQERSY-------------------------------SGR------QVLRLFLVGTS 155

  Fly   214 -KDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSVMALKHISRSCFNTAVYFLKCDDD 277
             .:||....:..:.:.:|:.:|.|::|.:|.|::.|||||.:..|...:..|...: :.|.||||
Mouse   156 PPEEAAREPQLADLLSLEAREYGDVLQWDFSDTFLNLTLKHLHLLDWTAEHCPGVS-FLLSCDDD 219

  Fly   278 TFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASSDVLYGHQFCNVVPVSEVSSK 342
            .||:..|:|:||                    .|.:|:..|      ..|......|||.|..||
Mouse   220 VFVHTANVLSFL--------------------EVQSPEHHL------FTGQLMVGSVPVRESGSK 258

  Fly   343 WYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYLEDVYITGLCAQKAKI-NRHHH 406
            :::|..::...:||.|.||.|:|:|...|:.|..|:.:..|..::|.|: |:|.|:|.: ...|.
Mouse   259 YFVPPQIFPGVAYPAYCSGGGFLLSRYTVRNLRSAAHHVPLFPIDDAYM-GMCLQQAGLAPSSHQ 322

  Fly   407 PLFSFA--------HSKQMCAFKGTITQHQLKDDSMVSAWNYVSNYSIKC 448
            .:..|.        .|...|.::..:..|:.....|:..|..:.|.::.|
Mouse   323 GIRPFGVQLPNVQRLSLDPCMYRELLLVHRFAPYEMLLMWKALHNPALHC 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 60/204 (29%)
B3gnt6NP_001074636.1 Galactosyl_T 126..318 CDD:304462 67/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847382
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42774
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.