DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3galt1

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001366253.1 Gene:B3galt1 / 26877 MGIID:1349403 Length:326 Species:Mus musculus


Alignment Length:325 Identity:101/325 - (31%)
Similarity:156/325 - (48%) Gaps:79/325 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 RNKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLS 194
            :|..||||.:.|....|..|..||||||:...|            ||                  
Mouse    75 KNIPFLVILISTTHKEFDARQAIRETWGDENNF------------KG------------------ 109

  Fly   195 GEGQSLTASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSVMALKH 259
                   ..:..:|::|:..|..:  |:.:.:   ||:.::|||.|:|:|||:|||||::|.::.
Mouse   110 -------IKIATLFLLGKNADPVL--NQMVEQ---ESQIFHDIIVEDFIDSYHNLTLKTLMGMRW 162

  Fly   260 ISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASSDV 324
            ::..| :.|.|.:|.|.|.|||:.||:..||..:                  |.|:.|       
Mouse   163 VATFC-SKAKYVMKTDSDIFVNMDNLIYKLLKPS------------------TKPRRR------- 201

  Fly   325 LYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYLEDV 389
            .:.....|..|:.:|.||||||..:|...:||.:.||.||:.|.||.:.:::.||:|.|::||||
Mouse   202 YFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDV 266

  Fly   390 YITGLCAQKAKINRHHHPL--FSFAHSK---QMCAFKGTITQHQLKDDSMVSAWNYVSNYS-IKC 448
            |: |||.:|..|    ||.  ..|.|.|   .:|.::..||.||:..:.|...||.:|:.. ::|
Mouse   267 YV-GLCLRKLGI----HPFQNSGFNHWKMAYSLCRYRRVITVHQISPEEMHRIWNDMSSKKHLRC 326

  Fly   449  448
            Mouse   327  326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 69/202 (34%)
B3galt1NP_001366253.1 Galactosyl_T 92..279 CDD:250845 79/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42774
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4102
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.910

Return to query results.
Submit another query.