DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B0024.3

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_505645.2 Gene:B0024.3 / 181815 WormBaseID:WBGene00007096 Length:254 Species:Caenorhabditis elegans


Alignment Length:173 Identity:30/173 - (17%)
Similarity:53/173 - (30%) Gaps:67/173 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DRRWNPEKIEEQSSLLAAEYSSSSGAAASGSED---ETVTTSGALRSKAKLRKRQLRNRMPLPRM 63
            |.|:..|||......:..||.       .|.:|   :.||.:....:::..              
 Worm   127 DSRYAQEKISPTEFPVMCEYQ-------IGEDDGQLQNVTFANGSHARSLF-------------- 170

  Fly    64 LRRLGCYTLSAFLICGLLLVYLPLVYLDVHKRSAGLPDWTSETSRSIADYLDIGLSSGVIVPKDF 128
               .|| ..|....||:...:                        :|.:|:..|:...:|.    
 Worm   171 ---FGC-PGSMLDCCGMYCCH------------------------NIGEYIFKGILFTIIA---- 203

  Fly   129 CRNKTFLVIAVCTGV------DNFIQRHTIRETWGNTTEFNYP 165
                .|:|..:|:.:      :||::....|.| ...||.:.|
 Worm   204 ----VFVVCVMCSSMIEDNRKNNFLRCGNSRTT-RTRTETDIP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462
B0024.3NP_505645.2 CX 124..187 CDD:366767 16/84 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165206
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.