DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and bus-2

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001255233.1 Gene:bus-2 / 176977 WormBaseID:WBGene00044618 Length:329 Species:Caenorhabditis elegans


Alignment Length:322 Identity:72/322 - (22%)
Similarity:124/322 - (38%) Gaps:95/322 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLSGEGQS 199
            :::.|.|....|..|:.:|::|.|.|                                       
 Worm    67 VLVLVTTIASEFEMRNQVRKSWANYT--------------------------------------- 92

  Fly   200 LTASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSVMALKHISRSC 264
             :.:||:.|::|...|      :.|..|..||:::||:|..:..:.|.:|..|::..|.:.:|..
 Worm    93 -SNAVRVKFLMGIPAD------KQLPLIQKESQEFNDLIIADLDEGYYSLASKTMAMLIYKTRYY 150

  Fly   265 FNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASSDVLYGHQ 329
            .:|.. .:|.|.|..:.:.|                   ::|......||         ::.|. 
 Worm   151 PDTKC-LVKADVDNVLILRN-------------------YERLCEEAVAP---------LILGK- 185

  Fly   330 FCNVV-PVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVV-QRLFEASLNTTLV-------Y 385
             |:|. .|...::||.:|.::|....||.|.|...|:::...| |.|.:.::::...       .
 Worm   186 -CDVSRTVLRNTTKWAVPEFVYSEPVYPTYCSTGTYVLAGKTVPQSLIKEAMSSPFANSLNFRKL 249

  Fly   386 LEDVYITGLCAQKAKINRHH-HPLFSFAHSKQMC--AFKGTITQHQLKDDSMVSAWNYVSNY 444
            .|||..||:.|:||.|.|.| :.|..|...:..|  .||.|.:.|.|.|.      |.|.|:
 Worm   250 SEDVIFTGILAEKAGIKRRHINGLSFFEIPEFFCRNGFKTTYSTHLLSDK------NPVKNF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 52/212 (25%)
bus-2NP_001255233.1 Galactosyl_T 81..269 CDD:304462 56/264 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.