DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3GALT6

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_542172.2 Gene:B3GALT6 / 126792 HGNCID:17978 Length:329 Species:Homo sapiens


Alignment Length:386 Identity:85/386 - (22%)
Similarity:124/386 - (32%) Gaps:113/386 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LPRMLRRLGCYTLSAFLICGLLLVYLPLVYLDVHKRSAGLPDWTSETSRSIADYLDIGLSSGVIV 124
            |.|..||.....|....:||..|:||                     :|..|:..|....||...
Human     4 LRRAWRRRAALGLGTLALCGAALLYL---------------------ARCAAEPGDPRAMSGRSP 47

  Fly   125 PKDF-CRNKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKM 188
            |... .|...||.:.|.:......:|..||.||                                
Human    48 PPPAPARAAAFLAVLVASAPRAAERRSVIRSTW-------------------------------- 80

  Fly   189 YGDYLSGEGQSLTASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYND-IIQENFVDSYNNLTLK 252
                |:..|  ....|...|.||    .|.||.|....:..|..::.| ::.....|:|.|||.|
Human    81 ----LARRG--APGDVWARFAVG----TAGLGAEERRALEREQARHGDLLLLPALRDAYENLTAK 135

  Fly   253 SVMAL-----KHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVT 312
             |:|:     :|::..      :.||.|||:|..:..||..|                       
Human   136 -VLAMLAWLDEHVAFE------FVLKADDDSFARLDALLAEL----------------------- 170

  Fly   313 APQTRLKASSDVLYGHQFC---NVVPVSE-VSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQR 373
              :.|..|....||...|.   .|.|... ..:.|.:..|      |..|..|.||::|.|:|..
Human   171 --RAREPARRRRLYWGFFSGRGRVKPGGRWREAAWQLCDY------YLPYALGGGYVLSADLVHY 227

  Fly   374 LFEASLNTTLVYLEDVYITGLCAQKAKINRHHHPLFSFAHSKQMCAFKGTITQHQLKDDSM 434
            |..:.......:.|||.: |.......:.|.|.|.|...:..:.|:.:..:|..|..:|.:
Human   228 LRLSRDYLRAWHSEDVSL-GAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDML 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 52/212 (25%)
B3GALT6NP_542172.2 Galactosyl_T 71..260 CDD:304462 59/269 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.