DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3GNT2

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001306004.1 Gene:B3GNT2 / 10678 HGNCID:15629 Length:397 Species:Homo sapiens


Alignment Length:343 Identity:92/343 - (26%)
Similarity:147/343 - (42%) Gaps:74/343 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 YLDIGLSSGVIVPKDFCRNKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGH 177
            ||.....|.:|...|.|..|.||::|:.:...:|.:|..|||:||.                   
Human   122 YLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQ------------------- 167

  Fly   178 YLPPLPDRLKMYGDYLSGEGQSLTASVRIVFIVGRQKDEAMLGN--ETLNRIHIESEKYNDIIQE 240
                              |..:...:|..||::|:...|   .|  :..:.:..||||:.||:..
Human   168 ------------------ESNAGNQTVVRVFLLGQTPPE---DNHPDLSDMLKFESEKHQDILMW 211

  Fly   241 NFVDSYNNLTLKSVMALKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHD 305
            |:.|::.||:||.|:.|:.:|.||.:|...| |.|||.|||..::||                  
Human   212 NYRDTFFNLSLKEVLFLRWVSTSCPDTEFVF-KGDDDVFVNTHHILN------------------ 257

  Fly   306 RSTYLVTAPQTRLKASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDV 370
               ||.:..:|:.|   |:..|....|..|..:...|:|:|..:|. ..||.|..|.|:|.|..:
Human   258 ---YLNSLSKTKAK---DLFIGDVIHNAGPHRDKKLKYYIPEVVYS-GLYPPYAGGGGFLYSGHL 315

  Fly   371 VQRLFEASLNTTLVYLEDVYITGLCAQKAKINRHHHPLF-SF----AHSKQMCAFKGTITQHQLK 430
            ..||:..:....|..::||| ||:|.||..:....|..| :|    .:...:|::...:..|..|
Human   316 ALRLYHITDQVHLYPIDDVY-TGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRK 379

  Fly   431 DDSMVSAWNYVSNYSIKC 448
            ...|:..|:.:.:..:||
Human   380 PQEMIDIWSQLQSAHLKC 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 64/204 (31%)
B3GNT2NP_001306004.1 Galactosyl_T 156..345 CDD:389837 71/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.