DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3galt9

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:XP_038962145.1 Gene:B3galt9 / 103691796 RGDID:9424697 Length:324 Species:Rattus norvegicus


Alignment Length:327 Identity:77/327 - (23%)
Similarity:131/327 - (40%) Gaps:76/327 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 VIVPKDFCRNKT-FLVIAVCTGVDNFIQRHTIRETWGNTTEF-NYPAFGKLHGHLKGHYLPPLPD 184
            |:...:.|..|| ||:..:.:...|..:|..||:|||:.|.. .||                   
  Rat    27 VLSQPEVCNGKTIFLLSLIFSSPGNATRRELIRKTWGSVTSVRGYP------------------- 72

  Fly   185 RLKMYGDYLSGEGQSLTASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNL 249
                               :..:|.:|.   .|::.  |...:..|:::.||||:..|:||..|.
  Rat    73 -------------------ILTLFALGM---PALVA--TQEELDAEAQENNDIIEGIFLDSSENQ 113

  Fly   250 TLKSVMALKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAP 314
            |||.:...:.....|.| |::.||.|:|||:|:|.|:::||                        
  Rat   114 TLKIISMTQWAVAFCPN-ALFVLKADEDTFINLPGLVDYLL------------------------ 153

  Fly   315 QTRLKASSDVLY-GHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEAS 378
              .||...:.:| |......:|..:..|:.::|...|..:.||.|.||..::||.||.:.:....
  Rat   154 --NLKGQMEGIYLGRVIHQDIPNRDPHSQEFVPLSEYPEKYYPDYCSGEAFIMSQDVARMMCVVL 216

  Fly   379 LNTTLVYLEDVYITGLCAQKAKINRHHHPLFSFAH--SKQMCAFKGTITQHQLKDDSMVSAWNYV 441
            ....::...||:: |:||:...:...|...||...  :...|.:|...|..:..|.....||..:
  Rat   217 NEAPIMVPADVFV-GICAKSLGLTPSHSSRFSGERHITYNRCCYKFIFTSSEATDAETSLAWKEM 280

  Fly   442 SN 443
            ::
  Rat   281 ND 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 53/203 (26%)
B3galt9XP_038962145.1 Galactosyl_T 54..242 CDD:419759 61/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.