DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and B3GNT3

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_055071.2 Gene:B3GNT3 / 10331 HGNCID:13528 Length:372 Species:Homo sapiens


Alignment Length:442 Identity:97/442 - (21%)
Similarity:167/442 - (37%) Gaps:123/442 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RQLRNRMPLPRMLRRLGCYTLSAFLICGLLLVYLPLVYLDVHKRSAGLPD---WTSETSR----- 108
            :.||:|.|...::..:|.:||..|    .|||..|.  ..|.::...:|:   |.:..:|     
Human     2 KYLRHRRPNATLILAIGAFTLLLF----SLLVSPPT--CKVQEQPPAIPEALAWPTPPTRPAPAP 60

  Fly   109 -----SIADYLDIGLSSGVI-----------------VPKDFCRNKTFLVIAVCTGVDNFIQRHT 151
                 |:..:.|.......:                 ||...|....||::.:.:...|:::|..
Human    61 CHANTSMVTHPDFATQPQHVQNFLLYRHCRHFPLLQDVPPSKCAQPVFLLLVIKSSPSNYVRREL 125

  Fly   152 IRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLSGEGQSLTASVRIVFIVGRQKD- 215
            :|.|||...        |:.|                             ..:|::|:||...: 
Human   126 LRRTWGRER--------KVRG-----------------------------LQLRLLFLVGTASNP 153

  Fly   216 -EAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSVMALKHISRSCFNTAVYFLKCDDDTF 279
             ||...|..|   .:|::.:.||:|.:|.||:.|||||.|:.|:.....|.| |.:.|..|||.|
Human   154 HEARKVNRLL---ELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCAN-ASFVLNGDDDVF 214

  Fly   280 VNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASSDVLYGHQFCNVVPVSEVSSKWY 344
            .:..|::.:            |..||...:|              ..|....||.|:....||:|
Human   215 AHTDNMVFY------------LQDHDPGRHL--------------FVGQLIQNVGPIRAFWSKYY 253

  Fly   345 MPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYLEDVYITGLCAQKAKINRHHHP-- 407
            :|..:.:.|.||.|..|.|:|:|......|..|:....:..::||:: |:|.:...:....|.  
Human   254 VPEVVTQNERYPPYCGGGGFLLSRFTAAALRRAAHVLDIFPIDDVFL-GMCLELEGLKPASHSGI 317

  Fly   408 -----------LFSFAHSKQMCAFKGTITQHQLKDDSMVSAWNYVSNYSIKC 448
                       |.||    ..|.::..:..|:.....|:..|:.::..::.|
Human   318 RTSGVRAPSQRLSSF----DPCFYRDLLLVHRFLPYEMLLMWDALNQPNLTC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 57/204 (28%)
B3GNT3NP_055071.2 Galactosyl_T 122..311 CDD:389837 64/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.