DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and Gm34653

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001363973.1 Gene:Gm34653 / 102637973 MGIID:5593812 Length:368 Species:Mus musculus


Alignment Length:321 Identity:77/321 - (23%)
Similarity:127/321 - (39%) Gaps:75/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 DFCRNKT-FLVIAVCTGVDNFIQRHTIRETWGN-TTEFNYPAFGKLHGHLKGHYLPPLPDRLKMY 189
            :.|..|| ||:..:.:...|..:|..||:.||: ||...||                        
Mouse    77 EVCNGKTIFLLSLIFSSPGNGTRRDLIRKAWGSVTTVQGYP------------------------ 117

  Fly   190 GDYLSGEGQSLTASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSV 254
                          :..:|.:|.   .|::  .|...|..||:|.||||:..|:||..|.|||.:
Mouse   118 --------------ILTLFALGM---PALV--TTQEEIDAESQKNNDIIEGIFLDSSENQTLKII 163

  Fly   255 MALKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLK 319
            ...:.....| .:|::.||. |:.|:|:|.|:::||         .|..|....||         
Mouse   164 SMTQWAVAFC-PSALFILKA-DEMFINLPGLVDYLL---------NLKGHLEGIYL--------- 208

  Fly   320 ASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLV 384
                   |......:|..:..|:.::....|..:.||.|.||..:::|.||.:.::.......::
Mouse   209 -------GRVIHQDIPNRDPHSQEFVSLSEYPEKYYPDYCSGEAFILSQDVARMVYVVLNEAPVM 266

  Fly   385 YLEDVYITGLCAQKAKINRHHHPLFSFAH--SKQMCAFKGTITQHQLKDDSMVSAWNYVSN 443
            ...||:: |:||:...:...|...||...  :...|.:|...|..::.|.....||..||:
Mouse   267 VPADVFV-GICAKSVGLIPIHSSRFSGERHITYNRCCYKFIFTSAEVTDAETSLAWKEVSD 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 52/202 (26%)
Gm34653NP_001363973.1 Galactosyl_T 99..286 CDD:389837 60/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.