DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and LOC101883349

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:XP_005161047.1 Gene:LOC101883349 / 101883349 -ID:- Length:370 Species:Danio rerio


Alignment Length:366 Identity:87/366 - (23%)
Similarity:137/366 - (37%) Gaps:112/366 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 FLICGLLLVYL----------------PLVY-----LDVHKRSAGLPDWTSETSRSIADYLDIGL 118
            ||:|.::|.:.                |..|     |:|.:|:..|            |..|..:
Zfish    15 FLLCNVILFHALLFGGDIVEEFLLQSSPAAYTDRFVLEVRERARKL------------DLTDPRV 67

  Fly   119 SSGVIVP--KDFCRNKTFLVI--AVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYL 179
            ::..:.|  .:.|.....|:|  .|.:...|..||..:|.:|.|.|..:                
Zfish    68 NTSQLYPINTEPCLPHLDLLILTVVLSSPGNSSQREAVRNSWANQTVVH---------------- 116

  Fly   180 PPLPDRLKMYGDYLSGEGQSLTASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYNDIIQ-ENFV 243
                                 ..:||.||.:|    .:.||.| |..|..|||:|.||:| |..:
Zfish   117 ---------------------NVAVRTVFFLG----ASPLGAE-LGVIKEESERYGDIVQFEGGI 155

  Fly   244 ---DSYNNLTLKSVMALKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHD 305
               |.......:..||||.|...| ..|.:.:..:|..::|:|.|.::|||              
Zfish   156 SRGDWQGGHWDQVKMALKWILHFC-PQARFIILSEDSVYLNLPALTSYLLG-------------- 205

  Fly   306 RSTYLVTAPQTRLKASSDVLY-GHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSID 369
                        |:...|.|| |.......|..:.....|:|..:|..:..|.|.||..:|:|.|
Zfish   206 ------------LRTHPDDLYLGRVIHRAAPERDPDKPHYLPYQVYPDKYLPDYCSGPAFLLSQD 258

  Fly   370 VVQRLFEASLNTTLVYLEDVYITGLCAQKAKINRHHHPLFS 410
            ||::::.|:.:.:|....|:.| ||||::|.:...|...||
Zfish   259 VVRKIYVAAEDASLPLPSDILI-GLCARRAGVVATHSARFS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 61/207 (29%)
LOC101883349XP_005161047.1 Galactosyl_T 100..289 CDD:304462 66/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.