DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and b3galt5.1

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:XP_002938778.1 Gene:b3galt5.1 / 100494507 XenbaseID:XB-GENE-992040 Length:314 Species:Xenopus tropicalis


Alignment Length:385 Identity:107/385 - (27%)
Similarity:159/385 - (41%) Gaps:89/385 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 MLRRLGCYTLSAFLIC-GLLLVYLPLV-YLDVHKRSAGLPDWTSETSRSIADYLDIGLSSGVIVP 125
            |||....:..:..:.| |..::.|.|. :..:.::....|...|.|.|....          :.|
 Frog     1 MLRLKWIFATTLLIFCFGFCVLLLNLQDFCTICRKRIYSPSLRSATVRETFQ----------LRP 55

  Fly   126 KDFC-RNKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMY 189
            |..| ||..|||:.|.|.......|:.||:|||                           :.::.
 Frog    56 KIQCERNPPFLVLLVTTTHSQKEARNVIRQTWG---------------------------KERLI 93

  Fly   190 GDYLSGEGQSLTASVRIVFIVGRQKDEAMLGNETLNRIHIESEKYNDIIQENFVDSYNNLTLKSV 254
            ||.|          |...|::|...:..:.|..|     .||..||||||.:|:|||.|||||::
 Frog    94 GDKL----------VSTYFLLGAGTNPRLQGELT-----GESNTYNDIIQRDFIDSYYNLTLKTI 143

  Fly   255 MALKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLK 319
            |.::.|...|..| .:.:|.|.|.|||             |||...|        ||...||   
 Frog   144 MGIEWICTHCPQT-TFVMKTDTDMFVN-------------PLYLVEL--------LVKKNQT--- 183

  Fly   320 ASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLV 384
              :||..|....:..|:....||:|:.:..|....||.:.||.||:.|:||.|::...|......
 Frog   184 --TDVFTGSLRLHDAPIRNNHSKYYISTTEYPLAKYPPFCSGTGYVFSVDVAQKIQNVSSTVPFF 246

  Fly   385 YLEDVYITGLCAQKAKI---NRHHHPLFSFAHSK--QMCAFKGTITQHQLKDDSMVSAWN 439
            .||||:: |:|.:|..|   |.|..|.| .|:.|  .:|.::..:|.|.::...:...|:
 Frog   247 KLEDVFV-GMCLEKVNINLQNLHTKPTF-HAYKKPFTICNYRKLVTSHGVRPRELYLFWD 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 69/205 (34%)
b3galt5.1XP_002938778.1 Galactosyl_T 78..268 CDD:389837 77/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.