DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and LOC100489278

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:XP_031755254.1 Gene:LOC100489278 / 100489278 -ID:- Length:387 Species:Xenopus tropicalis


Alignment Length:320 Identity:80/320 - (25%)
Similarity:136/320 - (42%) Gaps:84/320 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CRNKT-FLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDY 192
            ||.:. |||:.:.:...:.:.|..:|:||.|.:                 .:|.:          
 Frog   130 CRGEAPFLVLLIPSMPQDVLVRDALRKTWANES-----------------LIPGI---------- 167

  Fly   193 LSGEGQSLTASVRIVFIVGRQKDEAMLGNETLNRIHI----ESEKYNDIIQENFVDSYNNLTLKS 253
                      |::.:|::||         ..:|.|.|    ||..::||:|::|:|:|.|||:|:
 Frog   168 ----------SIKRIFLLGR---------SFVNDIEISVEQESSTFHDIVQQDFLDTYRNLTVKT 213

  Fly   254 VMALKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRL 318
            :|.::.:||.| ..|.|.:|.|.|.|.|...|:..:|                      .|:..|
 Frog   214 LMGIEWVSRLC-PRASYVMKVDADMFFNPWFLVRQIL----------------------QPEKPL 255

  Fly   319 KASSDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTL 383
            |.:  ...|.......|....:|||::....|...|||.|.||.||:.|..:...|:..::...:
 Frog   256 KLA--FFTGLVISGASPRRNKNSKWHILYSEYSKNSYPTYCSGTGYVFSGGLAPLLYRQAMELAI 318

  Fly   384 VYLEDVYITGLCAQK--AKINRHHHPLFS---FAHSKQMCAFKGTITQHQLKDDSMVSAW 438
            :.||||:: |||.|:  ..|:|.....|:   |.::.  |.|...:|.|..|...:::.|
 Frog   319 LPLEDVFL-GLCLQRIGLYISRPQQNWFNLDRFEYNG--CQFARLVTVHHYKPHQLLTLW 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 60/208 (29%)
LOC100489278XP_031755254.1 Galactosyl_T 151..335 CDD:419759 65/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4358
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.