DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and b3gnt2

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001123810.1 Gene:b3gnt2 / 100170561 XenbaseID:XB-GENE-957599 Length:397 Species:Xenopus tropicalis


Alignment Length:327 Identity:87/327 - (26%)
Similarity:140/327 - (42%) Gaps:74/327 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CRNKTFLVIAVCTGVDNFIQRHTIRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYL 193
            |.:|.||::|:.:.:..|.:|..|||:||...:.|                              
 Frog   138 CVDKPFLLLAIKSLIPQFDRRQAIRESWGKELKIN------------------------------ 172

  Fly   194 SGEGQSLTASVRIVFIVGRQKDEAMLGN--ETLNRIHIESEKYNDIIQENFVDSYNNLTLKSVMA 256
                   ..:|..||::|....|   .|  :....:..|||.:.||:..|:.||:.|||||.|:.
 Frog   173 -------NMTVVRVFLLGETPPE---DNYPDLSGMVKFESEIHKDILLWNYKDSFFNLTLKEVLF 227

  Fly   257 LKHISRSCFNTAVYFLKCDDDTFVNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKAS 321
            |:..|.|| ::|.:..|.|||.|||.|.:|:                     ||.|....:.|  
 Frog   228 LRWASHSC-SSAQFIFKGDDDVFVNTPLILD---------------------YLKTLSPEKAK-- 268

  Fly   322 SDVLYGHQFCNVVPVSEVSSKWYMPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYL 386
             |:..|....:..|..|.:.|:|:|..:| ..|||.|..|.|:|.|..|.|||:.|:....:..:
 Frog   269 -DLFIGDVIKDAGPHREKTLKYYIPESIY-VGSYPPYAGGGGFLYSGSVAQRLYNATSRVLIYPI 331

  Fly   387 EDVYITGLCAQKAKINRHHHPLFSF-----AHSKQMCAFKGTITQHQLKDDSMVSAWNYVSNYSI 446
            :||| ||:|.:|..::...|..|..     ...|.:|::...:..|..|...:::.|:.:.:..:
 Frog   332 DDVY-TGMCLEKIGVSPEKHKGFKTFDIDEKQKKSICSYTNIMLVHPRKPQEIITIWSRLQDSQL 395

  Fly   447 KC 448
            .|
 Frog   396 NC 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 66/204 (32%)
b3gnt2NP_001123810.1 Galactosyl_T 156..348 CDD:389837 73/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4358
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.