DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GalT1 and b3gnt9

DIOPT Version :9

Sequence 1:NP_788328.1 Gene:GalT1 / 36279 FlyBaseID:FBgn0053145 Length:466 Species:Drosophila melanogaster
Sequence 2:XP_005159205.1 Gene:b3gnt9 / 100034499 ZFINID:ZDB-GENE-060503-611 Length:451 Species:Danio rerio


Alignment Length:440 Identity:92/440 - (20%)
Similarity:161/440 - (36%) Gaps:134/440 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VTTSGALRSKAKLRKRQLRNRMPLPRMLRRLGCYTLSAFLICGLLLVYLPLVYLDVHKRSAGLPD 101
            |.|....:.::|::.::.|::             |.|.|.........||               
Zfish    76 VQTKSKPQGQSKVKPQKARSK-------------TKSKFQQASTTASLLP--------------- 112

  Fly   102 WTSETSRSIADYL---DIGLSSGVIVPKDF---------C---RNKTFLVIAVCTGVDNFIQRHT 151
              ::.|...||||   |         .:||         |   .:..:::||:.:...:|.:|..
Zfish   113 --TQHSFDFADYLRKKD---------QRDFKMLIDQPTKCSEPESAPYMLIAIKSVTTDFDKRQV 166

  Fly   152 IRETWGNTTEFNYPAFGKLHGHLKGHYLPPLPDRLKMYGDYLSGEGQSLTASVRIVFIVGRQKDE 216
            :|.|||....|                                    ....:::.||::|..:::
Zfish   167 VRRTWGREGVF------------------------------------QKNINIKRVFLLGVPQNQ 195

  Fly   217 AMLGNETL--NRIHIESEKYNDIIQENFVDSYNNLTLKSVMALKHISRSCFNTAVYFLKCDDDTF 279
            :.|   .|  ..:..||..:.||:..:|.|::.|||||.:..|:.|:.||..|...| |.|.|.:
Zfish   196 SAL---PLWDKLLEYESHTFGDILLWDFEDTFFNLTLKEIHFLQWINVSCPKTKFIF-KGDADVY 256

  Fly   280 VNIPNLLNFLLGGTIPLYNDTLDYHDRSTYLVTAPQTRLKASSDVLYGHQFCNVVPVSEVSSKWY 344
            |||.|:|..|....|                          ..|:..|....:..|:...|||::
Zfish   257 VNIDNILEMLESQEI--------------------------DKDLFVGDIIVHAKPIRRRSSKYF 295

  Fly   345 MPSYMYKPESYPKYLSGAGYLMSIDVVQRLFEASLNTTLVYLEDVYITGLCAQKAKINRHHHPLF 409
            :|.::|....||.|..|.|::||.....:|..|.....|..::||:: |:|..:..:....|..|
Zfish   296 VPEFIYGQGIYPSYAGGGGFVMSGHTALKLHLACKEVELFPIDDVFL-GMCLLRIGLQPTRHEGF 359

  Fly   410 --------SFAHSKQM---CAFKGTITQHQLKDDSMVSAWNYVSNYSIKC 448
                    |.|...|:   |.::..:..|.|....:...||.:.:.:::|
Zfish   360 RTFGIVKPSAAPHLQVFDPCFYRELMVVHSLTVPQIWLMWNLLHDPNLRC 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalT1NP_788328.1 Galactosyl_T 204..407 CDD:304462 54/204 (26%)
b3gnt9XP_005159205.1 Galactosyl_T 162..354 CDD:328824 60/258 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2287
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.