DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADD1 and dnmt3ab

DIOPT Version :9

Sequence 1:NP_725094.1 Gene:ADD1 / 36278 FlyBaseID:FBgn0026573 Length:1199 Species:Drosophila melanogaster
Sequence 2:XP_021322836.1 Gene:dnmt3ab / 553189 ZFINID:ZDB-GENE-050314-3 Length:983 Species:Danio rerio


Alignment Length:110 Identity:30/110 - (27%)
Similarity:44/110 - (40%) Gaps:11/110 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 HPILRVTHCVKCHDFYNSGEFSKGEDGSELYCRWCGQGGEVYCC--STCPYVFCKSCIVKNLSKG 148
            ||:.....|..|.:.:....:...:||.:.||..|..|.||..|  :.|...||..|:...:..|
Zfish   575 HPLFIGGMCQSCTNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPG 639

  Fly   149 VIVDIEQNENWNCFSCTSKIL---------WPLRAQHWALVNYLQ 184
            ......:.:.|||:.|..|..         ||.|.||:...|:.|
Zfish   640 AAQAAIKEDPWNCYMCGLKTQYGLLERRADWPCRLQHFFANNHDQ 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADD1NP_725094.1 ADDz_ATRX 62..164 CDD:277252 21/79 (27%)
dnmt3abXP_021322836.1 Dnmt3b_related 364..450 CDD:99896
ADDz_Dnmt3a 556..683 CDD:277255 29/107 (27%)
Dcm 701..>864 CDD:223348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.