DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADD1 and Dnmt3b

DIOPT Version :9

Sequence 1:NP_725094.1 Gene:ADD1 / 36278 FlyBaseID:FBgn0026573 Length:1199 Species:Drosophila melanogaster
Sequence 2:NP_001003959.1 Gene:Dnmt3b / 444985 RGDID:1303274 Length:859 Species:Rattus norvegicus


Alignment Length:173 Identity:41/173 - (23%)
Similarity:66/173 - (38%) Gaps:38/173 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DFTSSKFEMHPSL------------SDEERRFYLKMYPNVDLVNQR---KVHCTVCKLHLGTAPA 78
            ||.:|::...|..            .|||.|..:..    |:.|.:   :..|..|        .
  Rat   392 DFAASEYSTPPKRLKTNSYGGKDRGEDEESRERMAS----DVTNNKGNLEDRCLSC--------G 444

  Fly    79 AESNIKMHPILRVTHCVKCHDFYNSGEFSKGEDGSELYCRWCGQGGEVYCCS--TCPYVFCKSCI 141
            .::.:..||:.....|..|.|.:....:...|||.:.||..|.:|.|:..||  :|...||..|:
  Rat   445 KKNPVSFHPLFEGGLCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECL 509

  Fly   142 VKNLSKGVIVDIEQNENWNCFSCTSK----IL-----WPLRAQ 175
            ...:..|...|.:..|.|:|:.|..:    :|     |.:|.|
  Rat   510 EVLVGTGTAEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQ 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADD1NP_725094.1 ADDz_ATRX 62..164 CDD:277252 26/106 (25%)
Dnmt3bNP_001003959.1 Dnmt3b_related 229..315 CDD:99896
ADDz_Dnmt3b 436..555 CDD:277254 31/125 (25%)
Dcm 580..>762 CDD:223348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto97953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.960

Return to query results.
Submit another query.