DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADD1 and Dnmt3l

DIOPT Version :9

Sequence 1:NP_725094.1 Gene:ADD1 / 36278 FlyBaseID:FBgn0026573 Length:1199 Species:Drosophila melanogaster
Sequence 2:NP_001003964.2 Gene:Dnmt3l / 309680 RGDID:1303239 Length:422 Species:Rattus norvegicus


Alignment Length:253 Identity:61/253 - (24%)
Similarity:83/253 - (32%) Gaps:58/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PSPSPLAK----LDADFTSSKFEMHPSLSDEERRFYLKMYPNVDLVNQRKVH--CTVCKLHLGTA 76
            |..||..|    :|.....||..:.|| |....|..::...|   ||||.:.  |..|    |:.
  Rat    38 PKSSPDLKEEDSVDMVLEDSKEPLTPS-SPPTGREVIRYEVN---VNQRNIEDICLCC----GSL 94

  Fly    77 PAAESNIKMHPILRVTHCVKCHDFYNSGEFSKGEDGSELYCRWCGQGGEVYCCST--CPYVFCKS 139
            ..    ...||:.....|..|.|.:....|...|||.:.||..|..|..::.|.:  |...:|..
  Rat    95 QV----YAQHPLFEGGICAPCKDKFLETLFLYDEDGHQSYCTICCSGHTLFICESPDCTRCYCFE 155

  Fly   140 CIVKNLSKGVIVDIEQNENWNCFSCTSKILWPLRAQHWALVNYLQTQKRALQTLQLPEVEARRQM 204
            |:...:..|....|.....|.||.|..          ::....||.:|:            .|..
  Rat   156 CVDILVGPGTSERINAMACWVCFLCLP----------FSRSGLLQRRKK------------WRHQ 198

  Fly   205 LK---DNSNCCRLAKSKTSSLSDSME----SLESNVSKR---------SQGSSAGSSK 246
            ||   |......:...||.|......    ||..|:.|.         |.||..|:.|
  Rat   199 LKAFHDREGASPVEIYKTVSAWKRQPVRVLSLFGNIDKELKSLGFLESSSGSEGGTLK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADD1NP_725094.1 ADDz_ATRX 62..164 CDD:277252 26/105 (25%)
Dnmt3lNP_001003964.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.