DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADD1 and dnmt3bb.2

DIOPT Version :9

Sequence 1:NP_725094.1 Gene:ADD1 / 36278 FlyBaseID:FBgn0026573 Length:1199 Species:Drosophila melanogaster
Sequence 2:NP_571461.1 Gene:dnmt3bb.2 / 30659 ZFINID:ZDB-GENE-990712-11 Length:1448 Species:Danio rerio


Alignment Length:185 Identity:42/185 - (22%)
Similarity:68/185 - (36%) Gaps:36/185 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PSLSDEERRFYLKMYPNVD--LVNQRKVH--CTVCKLHLGTAPAAESNIKMHPILRVTHCVKCHD 99
            |::..|.|:...|.:..|.  |.|:||:.  |..|        .:.|...:||:.....|..|..
Zfish   993 PTVQIESRQNSQKRHQMVHEFLKNKRKIEDFCLSC--------GSMSVDIIHPLFEGKLCTNCKF 1049

  Fly   100 FYNSGEFSKGEDGSELYCRWCGQGGEVYCC--STCPYVFCKSCIVKNLSKGVIVDIEQNENWNCF 162
            .:....:...|||.:.||..|..|.||..|  .:|...||..|:...:.:|....::..:.|.|:
Zfish  1050 NFTETLYRYDEDGYQSYCTVCCSGMEVILCGHDSCCRSFCVDCLDILVCQGTFDQLKNVDPWTCY 1114

  Fly   163 SCTSKIL---------WPLRAQ-------------HWALVNYLQTQKRALQTLQL 195
            .|..:..         |.:|.|             |....:....|:|.::.|.|
Zfish  1115 LCAPETSSGALKPRHDWSIRVQEFFANDTGMEFEPHRVYPSIPAIQRRPIRVLSL 1169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADD1NP_725094.1 ADDz_ATRX 62..164 CDD:277252 26/105 (25%)
dnmt3bb.2NP_571461.1 CH 16..>81 CDD:278723
Dnmt3b_related 790..873 CDD:99896
PHD_SF 1020..1139 CDD:304600 28/126 (22%)
Dcm 1163..>1325 CDD:223348 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.