DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ADD1 and DNMT3B

DIOPT Version :9

Sequence 1:	NP_725094.1	Gene:	ADD1 / 36278	FlyBaseID:	FBgn0026573	Length:	1199	Species:	Drosophila melanogaster
Sequence 2:	NP_008823.1	Gene:	DNMT3B / 1789	HGNCID:	2979	Length:	853	Species:	Homo sapiens

Alignment Length:	131	Identity:	32/131 - (24%)
Similarity:	52/131 - (39%)	Gaps:	18/131 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly    57 DLVNQRKVHCTVCKLHLGTAPAAESN-IKMHPILRVTHCVKCHDFYNSGEFSKGEDGSELYCRWC 120
            |:.|.:.      .|..|.......| :..||:.....|..|.|.:....:...:||.:.||..|
Human   423 DVANNKS------SLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVC 481

  Fly   121 GQGGEVYCCS--TCPYVFCKSCIVKNLSKGVIVDIEQNENWNCFSCTSK----IL-----WPLRA 174
            .:|.|:..||  :|...||..|:...:..|...:.:..|.|:|:.|..:    :|     |.:|.
Human   482 CEGRELLLCSNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRL 546

  Fly   175 Q 175
            |
Human   547 Q 547

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ADD1	NP_725094.1	ADDz_ATRX	62..164	CDD:277252	25/104 (24%)
DNMT3B	NP_008823.1	Interaction with DNMT1 and DNMT3A. /evidence=ECO:0000269\|PubMed:12145218	1..298
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..218
		Dnmt3b_related	223..309	CDD:99896
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	341..423		32/131 (24%)
		ADDz_Dnmt3b	431..550	CDD:277254	30/117 (26%)
		Interaction with the PRC2/EED-EZH2 complex. /evidence=ECO:0000250	435..527		23/91 (25%)
		Dcm	574..>756	CDD:223348
		S-adenosyl-L-methionine binding. /evidence=ECO:0000250\|UniProtKB:Q9Y6K1	582..586
		S-adenosyl-L-methionine binding. /evidence=ECO:0000250\|UniProtKB:Q9Y6K1	627..629
		S-adenosyl-L-methionine binding. /evidence=ECO:0000250\|UniProtKB:Q9Y6K1	832..834
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
User_Submission	0	0.000	Not matched by this tool.
	1	0.960