DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADD1 and Dnmt3b

DIOPT Version :9

Sequence 1:NP_725094.1 Gene:ADD1 / 36278 FlyBaseID:FBgn0026573 Length:1199 Species:Drosophila melanogaster
Sequence 2:XP_006498745.1 Gene:Dnmt3b / 13436 MGIID:1261819 Length:872 Species:Mus musculus


Alignment Length:188 Identity:45/188 - (23%)
Similarity:73/188 - (38%) Gaps:40/188 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SNSAPGSESGLAKVATPSPSPLAKLDADFTSSKFEMHPSLSDEERRFYLKMYPNVDLVNQR---K 63
            :|.:..|||       |.|..| |.::.....:.|      |||.|..:..    ::.|.:   :
Mouse   403 TNDSAASES-------PPPKRL-KTNSYGGKDRGE------DEESRERMAS----EVTNNKGNLE 449

  Fly    64 VHCTVCKLHLGTAPAAESNIKMHPILRVTHCVKCHDFYNSGEFSKGEDGSELYCRWCGQGGEVYC 128
            ..|..|        ..::.:..||:.....|..|.|.:....:...|||.:.||..|.:|.|:..
Mouse   450 DRCLSC--------GKKNPVSFHPLFEGGLCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLL 506

  Fly   129 CS--TCPYVFCKSCIVKNLSKGVIVDIEQNENWNCFSCTSK----IL-----WPLRAQ 175
            ||  :|...||..|:...:..|...|.:..|.|:|:.|..:    :|     |.:|.|
Mouse   507 CSNTSCCRCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQ 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADD1NP_725094.1 ADDz_ATRX 62..164 CDD:277252 26/106 (25%)
Dnmt3bXP_006498745.1 Dnmt3b_related 242..328 CDD:99896
ADDz_Dnmt3b 448..567 CDD:277254 31/125 (25%)
Dcm 593..>755 CDD:223348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.