DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PI31 and AT1G48530

DIOPT Version :9

Sequence 1:NP_001260905.1 Gene:PI31 / 36277 FlyBaseID:FBgn0033669 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_175286.2 Gene:AT1G48530 / 841274 AraportID:AT1G48530 Length:175 Species:Arabidopsis thaliana


Alignment Length:170 Identity:33/170 - (19%)
Similarity:64/170 - (37%) Gaps:43/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KTVKADVSKKSDLLIALVH-------FLLT------------KHYNFRC-VGVGDDKTLPEEEGS 65
            ::|......|:|.:..:||       |:||            .....:| ||:            
plant    23 RSVMPAFRNKNDKIAFVVHASLAVSGFILTSTGRPAFAHDALSSSTTQCLVGI------------ 75

  Fly    66 ELLPDSWNDDDTKYSLRYVHDKMLYLLLGHITEGSLLINLLDINTKKVSNICVEPETLVPE--VK 128
                :.||:.|.:|:..|......||:........||::.:..:.|:..::.:|....:.|  .:
plant    76 ----EGWNEFDEEYAFVYKCPVKRYLVKCLAMNDKLLVDAIAEDGKEFGHLQIEVGNYIDESGEE 136

  Fly   129 GGITTIMPSASEIVERYRRELLDPVFTGNSREVTTQTTNS 168
            |...|...:..::|...:.|:|..:.|     |:|.|.:|
plant   137 GDYDTQFKNFDKLVTELKSEILCKLNT-----VSTTTKSS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PI31NP_001260905.1 PI31_Prot_N 23..159 CDD:288423 29/157 (18%)
AT1G48530NP_175286.2 PI31_Prot_N 27..161 CDD:288423 27/149 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1614691at2759
OrthoFinder 1 1.000 - - FOG0005143
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13266
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.