DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PI31 and CG12729

DIOPT Version :9

Sequence 1:NP_001260905.1 Gene:PI31 / 36277 FlyBaseID:FBgn0033669 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_572271.1 Gene:CG12729 / 31515 FlyBaseID:FBgn0029816 Length:233 Species:Drosophila melanogaster


Alignment Length:154 Identity:54/154 - (35%)
Similarity:87/154 - (56%) Gaps:9/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YGWDLLYKTVKADVSKKSDLLIALVHFLLTKHYNFRCV---GVGDDKTLPEEEGS--ELLPDSWN 73
            :.|.||..::::.:.||||||||:.|||:||.|..||.   ...|.:.|....|:  |.|||.||
  Fly    41 HDWQLLLHSIQSHIRKKSDLLIAVTHFLITKEYRLRCAINYSASDGRQLAGGCGTVCEQLPDHWN 105

  Fly    74 DDDTKYSLRYVHDKML--YLLLGHITEGSLLINLLDINTKKVSNICVEPETLVPEV-KGGITTIM 135
            .|..:|:|.|. |.:.  |:|:..::...|:|:|.:..:|:::.:|::||.||... |..:...:
  Fly   106 RDADRYTLNYT-DGLAGQYILMAKLSRRDLVISLQNSTSKRMAIVCLQPEHLVNSTCKSSMDKCI 169

  Fly   136 PSASEIVERYRRELLDPVFTGNSR 159
            |...:.::|.|.||:||...|..|
  Fly   170 PRLDKFIKRLRAELVDPAVRGTKR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PI31NP_001260905.1 PI31_Prot_N 23..159 CDD:288423 50/143 (35%)
CG12729NP_572271.1 PI31_Prot_N 50..193 CDD:288423 50/143 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464277
Domainoid 1 1.000 62 1.000 Domainoid score I10344
eggNOG 1 0.900 - - E1_KOG4761
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1614691at2759
OrthoFinder 1 1.000 - - FOG0005143
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.