DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment exp and Smad2

DIOPT Version :9

Sequence 1:NP_725091.1 Gene:exp / 36276 FlyBaseID:FBgn0033668 Length:1025 Species:Drosophila melanogaster
Sequence 2:NP_001239410.1 Gene:Smad2 / 17126 MGIID:108051 Length:467 Species:Mus musculus


Alignment Length:185 Identity:42/185 - (22%)
Similarity:80/185 - (43%) Gaps:26/185 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 TQIDDEIWAKVIVFERNRRVAKAY-ARAPVLTINGSDDGFDGMRIGLCGFDNPMRDQKTDEMKRV 113
            |..:...|..:..:|.|:||.:.: |..|.||::|..|..:..|..|....|..|:...:..:|.
Mouse   267 TYSEPAFWCSIAYYELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRH 331

  Fly   114 IGQGVKIKMDDAGNILIRRYAKSNVYVKSTASSPNEETSIG---AEILKLP---NQALESEKIVK 172
            ||:||::.. ..|.:.....:.|.::|:    |||.....|   |.:.|:|   |        :|
Mouse   332 IGRGVRLYY-IGGEVFAECLSDSAIFVQ----SPNCNQRYGWHPATVCKIPPGCN--------LK 383

  Fly   173 LFDMKKFQSNVNRELRRAYPDRRRLETQCLSAVAFVKS------ENDILECPIWV 221
            :|:.::|.:.:.:.:.:.:....:|...|...::|||.      ...:...|.|:
Mouse   384 IFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
expNP_725091.1 MH2 56..224 CDD:294046 41/179 (23%)
Smad2NP_001239410.1 MH1_SMAD_2_3 8..172 CDD:199815
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..251
PY-motif. /evidence=ECO:0000250 221..225
MH2_SMAD_2_3 266..456 CDD:199826 42/185 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3018
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.