DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip48C and zipt-17

DIOPT Version :9

Sequence 1:NP_610712.1 Gene:Zip48C / 36273 FlyBaseID:FBgn0033665 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_503096.2 Gene:zipt-17 / 183065 WormBaseID:WBGene00006487 Length:386 Species:Caenorhabditis elegans


Alignment Length:250 Identity:52/250 - (20%)
Similarity:87/250 - (34%) Gaps:61/250 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 STNMMIQMTQSKAKADIAIEDSKRNGVAPDRLASKSLDSFSDCLSVQHSGESRRRKKGASINEME 170
            ||:..|:.:.|......:.||:..:....:|..|..|             |.||.:.|..:..:.
 Worm   166 STHSDIKSSASNHSITGSEEDNNNDSSKKERRNSVEL-------------EKRREQGGHELISLR 217

  Fly   171 QCTYTTPEEQQRAEDALSQWKRIMLLVVAITVHNIPEGLAVGVSF------GAIGSTNSSTFESA 229
            :      :......:......|.::::....|||:.:|||:|.||      |.|           
 Worm   218 E------DGDDDGTEICGLKPRALIILFGDGVHNLVDGLAMGASFMISVKLGFI----------- 265

  Fly   230 RNLAIGIGIQNFPEGLAVSLPLHAAGFSVKRALWYGQLSGMVEPIFGVLGAVAVTFANLIL---- 290
              ..|.:.....|..:.....|..:|.|:..||....||        .|.|.|..|..::|    
 Worm   266 --TTIAVICHELPHEIGDLAVLIDSGLSMCTALILNLLS--------ALTAYAGLFIAIVLGRDE 320

  Fly   291 ---PYALSFAAGAMIYIVSDDILPEAHASGNGTIAT-WGT-----VSGFLIMMCL 336
               ...|:..||..:|:...|:|  :|...:..:|. |..     :|||.:...|
 Worm   321 EIETILLAITAGMFLYVAWVDML--SHLKHDSLMADHWMVTSILQLSGFTLGFAL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip48CNP_610712.1 ZupT 23..340 CDD:223505 51/249 (20%)
zipt-17NP_503096.2 Zip 9..378 CDD:280666 51/249 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.