DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip48C and LOC110440161

DIOPT Version :9

Sequence 1:NP_610712.1 Gene:Zip48C / 36273 FlyBaseID:FBgn0033665 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_021336137.1 Gene:LOC110440161 / 110440161 -ID:- Length:344 Species:Danio rerio


Alignment Length:188 Identity:109/188 - (57%)
Similarity:134/188 - (71%) Gaps:7/188 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 FSDCLSVQHSGESRRRKKGASINEMEQCTYTTPEEQQ-RAEDALSQWKRIMLLVVAITVHNIPEG 208
            |..|.....:||..:|::|.|.....:....:|:.|: |.:...|.|:||:||::|||:||||||
Zfish    93 FDMCFYKIENGEVYQRRRGPSAGGHTEEQEVSPKAQEVRGQTGSSSWRRIVLLILAITIHNIPEG 157

  Fly   209 LAVGVSFGAIGSTNSSTFESARNLAIGIGIQNFPEGLAVSLPLHAAGFSVKRALWYGQLSGMVEP 273
            |||||.|||||.|.|:|||||||||||||||||||||||||||..:|.|..|:.|||||||||||
Zfish   158 LAVGVGFGAIGKTPSATFESARNLAIGIGIQNFPEGLAVSLPLRGSGVSTWRSFWYGQLSGMVEP 222

  Fly   274 IFGVLGAVAVTFANLILPYALSFAAGAMIYIVSDDILPEAHASGNGTIATWGTVSGFL 331
            :.|:||||||..|..:|||||:||||||:|:|.|||:|||.      |..|...:|.|
Zfish   223 LAGLLGAVAVVLAEPLLPYALAFAAGAMVYVVLDDIIPEAQ------IRQWKRETGLL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip48CNP_610712.1 ZupT 23..340 CDD:223505 109/188 (58%)
LOC110440161XP_021336137.1 ZupT <124..263 CDD:223505 97/138 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D398036at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.